SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004993 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004993
Domain Number 1 Region: 1238-1380
Classification Level Classification E-value
Superfamily PH domain-like 8.34e-49
Family Phosphotyrosine-binding domain (PTB) 0.00000147
Further Details:      
 
Domain Number 2 Region: 276-403
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.63e-36
Family PLC-like (P variant) 0.003
Further Details:      
 
Domain Number 3 Region: 109-273
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.53e-30
Family Dual specificity phosphatase-like 0.00026
Further Details:      
 
Domain Number 4 Region: 1094-1226
Classification Level Classification E-value
Superfamily SH2 domain 5.79e-22
Family SH2 domain 0.0021
Further Details:      
 
Domain Number 5 Region: 4-52
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000105
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004993   Gene: ENSGMOG00000004659   Transcript: ENSGMOT00000005138
Sequence length 1383
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1205:159:61128:1 gene:ENSGMOG00000004659 transcript:ENSGMOT00000005138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGEPHVFKEKTFKKKRQCSVCRQGVDGLGSFCRVCKTATHRKCESKANSPCVPAPSNDLD
QQRRGTAPSRHIQHLGSTKSLNCTKQRSTLPRSFSVDRVMERVMERNYDFDLTYITERII
SVFFPPLLDEQRYRVNLKEVTAMLRSKHQDKFLLFNLSEKRHDISRLNPKVHDFGWPDLH
APPLDKICAMCKAMETWLTSDPQHVVVLHCKGNKGKTGVIMAAYMHYSKISAGADQALST
LAMRKFCEDKVSSSLQPSQNRYIYYFGGLLSGAIKMNSSPLFLHQVLIPSLPNFQGEQGY
YPFVKIYQSMQLVYTSGIYDLQGTGGRRLCVTVDPALLLKGDIMVKCYHRRAQTADRDTV
FRLQFHTCTVHGSQLWFGKSELDEACTDERFPSDATVEFVFSSGPEKIKGREIQKNDPAV
TVDYNTGDPVVRWDSYENFNERFQDSLEDIAHTRGPVDGSLYAQIKKRRCPNSGSLSSTN
GSSPGGGFVDERPNTRSRPPCDSSTFSAHSNQVHPAGRQAPSPPTRQEREELDRMLGGIE
GGGSRDGERETAILDDGDSLPSDRRGTMRLGRSCSXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVHGPAACSTPSDMSGPPTPVHTSSPMCPPRQLRXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXQPGSPEGDGPAPWGDSPPPPPSPPSSQQHHVTFSPTV
GELAPSGGQTEAVEPESPTRVSVKFVQDSSRFWYKPSISREQAIAALKEREPGAFLIRDS
NSFQGAYGLALKVATPPANISNHSMVDPQEQLVRHFLIETGSRGVKIKGCQNEPYFGSLS
ALVYQHSITPISLPCTLRIPDKELIGVGQEVHPPSNMSSAADLLKQGAACNVLYLNSVET
ESLTGPQAIAKATDATMGRSPRPAATVVQFKVTAQGITLTDSQRRLFFRRHYPVTSVTYS
SIDPKDRRWANSDNKSVQVFGFVARKPGSVAENVCHLFAELDPEQPASAIINFINKVMLS
QCR
Download sequence
Identical sequences ENSGMOP00000004993 ENSGMOP00000004993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]