SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005020 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005020
Domain Number 1 Region: 306-484
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-51
Family DBL homology domain (DH-domain) 0.0000000114
Further Details:      
 
Domain Number 2 Region: 492-611
Classification Level Classification E-value
Superfamily PH domain-like 2.27e-34
Family Pleckstrin-homology domain (PH domain) 0.00000098
Further Details:      
 
Domain Number 3 Region: 117-257
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-20
Family Spectrin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005020   Gene: ENSGMOG00000004665   Transcript: ENSGMOT00000005166
Sequence length 636
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1396:1143978:1159043:-1 gene:ENSGMOG00000004665 transcript:ENSGMOT00000005166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDLQVADHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKL
GPNCESDHVTPMISKHQEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMLSHVKAPET
QVKNILNELLQRENRVLHFWTMRKRRLDQCQQYVVFERSAKQALEWIHDTGDFYLSTHTS
TGSSIHHTQELLKEHEDFQITAKQQTKERVKLLIQLADGFCDKGHAHAVEIKKWVASVDK
RYRDFSMRMDKYRGCLESALGISSDSNKASKDLQLDIIPASAPGSEVKLRDAAHDLNEEK
RKSARRKEFIMAELIQTEKTYVRDLRECMDTYLWEMTSGVEEIPPGIINKEHIIFGNMQD
LYEFHHNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVNYCKNKPDSTQLILEHAGPYFD
EIQQRHRLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRAND
AMHLSMLDGGFDGNIDSQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDS
NGHSKYLYKSKMFTSELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKH
IREVIQERTIHLRGALKEPIHMPKATTTKHKGRRYG
Download sequence
Identical sequences ENSGMOP00000005020 ENSGMOP00000005020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]