SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005047 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005047
Domain Number 1 Region: 131-513
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.7e-150
Family Myotubularin-like phosphatases 0.0000000000461
Further Details:      
 
Domain Number 2 Region: 9-127
Classification Level Classification E-value
Superfamily PH domain-like 2.66e-38
Family GRAM domain 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005047   Gene: ENSGMOG00000004737   Transcript: ENSGMOT00000005194
Sequence length 573
Comment pep:novel genescaffold:gadMor1:GeneScaffold_185:19624:28228:-1 gene:ENSGMOG00000004737 transcript:ENSGMOT00000005194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKMDLLADVALLPGEERVTDKELIYICPFNGALKGKVFITNYRLFFKSTEAEALTLDVPL
GVISRVEKMGGASSRGENSYGLDITCKDMRSLRFALKQEGHSRRDIFEILSKYAFPLSHS
QPLFSYLSQEKYEENGWSIYKPLEEFRRQGLPNERWRITFINKNYELCDTYPTILAVPYR
ASEEDLRRVAAFRSRGRIPVLSWIQRDNQAAIARCSQPLVGMSGKRNKDDERYLELLRET
NGTPKLTIFDARPSVNAVANKATGGGYEGDEYQNAELIFLDIHNIHVMRESLKKLRDIVY
PTVEESHWLSSLESTHWLEHIKLVLAGAIRVADKVSGGKSVVLHCSDGWDRTAQLSSLAM
LMLDSHYRTLRGFEVLIEKEWLSFGHKFASRIGHGDKNHADQDRSPIFVQFIDCVWQMTK
QFPTAFEFNERLLATVLEHLYSCRFGTFLFNCESMRELNEVRSKTVSLWSYVHSSSTRYL
NPFYTPESGRVLYPVASMRHLELWVSYYIRWNPRIRQQXXXXXXXXXKELLVLRDEYLRK
LEEQPLSSLRPHDLPRPAPRPPPQQFTHLHTPF
Download sequence
Identical sequences ENSGMOP00000005047 ENSGMOP00000005047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]