SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005168 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005168
Domain Number 1 Region: 218-264
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000802
Family Plexin repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005168   Gene: ENSGMOG00000004882   Transcript: ENSGMOT00000005323
Sequence length 373
Comment pep:novel genescaffold:gadMor1:GeneScaffold_926:228:13038:1 gene:ENSGMOG00000004882 transcript:ENSGMOT00000005323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDTDHNYYTSKTYGPADPLSKGFWVDIDQMDKDKVKVHGILSNTHRQAARVNLSFDFPFY
GHNLREVTVATGGFIYTGDVVHRMLTATQYIAPLMANFDPSVSRNSTVIYTDNGTALVVQ
WDHVRLQDLDHLGSFTFQASLHRDGRIVFAYREVPMDVSQISSVNHPVKVGLSDAFVVLD
HVQQIPNVRRRTIYEYHRVELVKTKISNSTAVEITPLPTCLQFTDCSSCISTQISFNCTW
CHRLHRCSSGFDRHRQDWVDNSCPDETKDKSCDIILTTRGPWTTTTVVRTTSRSQETDAG
PGVRSSTHTPTSVPTEXXXXXXXXXXXXXGTRPLHTGLILAVVVVMVVLVAGLVLSLYVY
HHPTSTTGLFFIE
Download sequence
Identical sequences ENSGMOP00000005168 ENSGMOP00000005168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]