SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005211 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005211
Domain Number 1 Region: 82-160
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000739
Family Pointed domain 0.071
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000005211
Domain Number - Region: 22-59,183-243
Classification Level Classification E-value
Superfamily EF-hand 0.0068
Family Calmodulin-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005211   Gene: ENSGMOG00000004792   Transcript: ENSGMOT00000005367
Sequence length 487
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4007:10776:23147:-1 gene:ENSGMOG00000004792 transcript:ENSGMOT00000005367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFADLCMMVSPPCVSEADRYSLEALRSIHQMMDDDHDGGIEVEESVEFIIILYYYYIINL
EHKHCHQTENQFTAKDTFQDSSNTVHNWTQDAVLRWLKGFVELPQYERNFMDFKVNGNTL
PRIAANEPAFLSGHLRIQDQRDKQKLNIKALDVVLFGPPTRPPHNYMKDLLLIVSVVMGI
GGCWFAQTQNKVSKIHISKMMKDLDSLQRAELSLQELQVRLERAQEEKRNVAEEKHHLEE
KMRDEIMGAQQEAHRLHRLRQGAVTELSRLRYAEEELEQVRGALKQAEKDMQLSCSASEG
LQLWLQLTHEVEVQYYSVKRQSAELQLASAKEELNALLLSLKAEKIKKKRSSLLGTLHVA
HSSSLDQVDHKILEAKNALSDVTACLRERLHRWQQVERLCGFPIFRNAGLAHLTAMLYSE
PVPVPVSRGQASYSCQSSLHGSMEDLMEDSSASIMSQMPGSSLKRSPRPRGSVICRLRRP
GVIVPPQ
Download sequence
Identical sequences ENSGMOP00000005211 ENSGMOP00000005211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]