SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005293 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005293
Domain Number 1 Region: 12-132,169-277
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.5e-24
Family Calponin-homology domain, CH-domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005293   Gene: ENSGMOG00000004996   Transcript: ENSGMOT00000005452
Sequence length 280
Comment pep:novel genescaffold:gadMor1:GeneScaffold_885:308585:316549:1 gene:ENSGMOG00000004996 transcript:ENSGMOT00000005452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQPTSLLDPKVEKLKDVLTSWINKTLTPDHIVVQSLDEDLFDGLVLHHLLARLAGVSLSV
DEIAVTAAAQIHKLGVVLEEVNKRLGLTDDALAKWNVQLIHNKDLLATIHLLVTMVRHFQ
PDLALPPNVKVEVVLVEVTKTGIKSDIQSEDLTEEEDPIEKLLTLDAHKILLAKTSIVNF
VNQNMSSMGLQVADLDTQFSDGVILLLLIGQLEGFFIPLCDFHLSPANHAEMVHNVTLAC
DFLLDIGLNVPNIDPEDIISRDVGATLKVLYALFRRHKGK
Download sequence
Identical sequences ENSGMOP00000005293 ENSGMOP00000005293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]