SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005299 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005299
Domain Number 1 Region: 311-435
Classification Level Classification E-value
Superfamily EF-hand 2.87e-45
Family EF-hand modules in multidomain proteins 0.00000894
Further Details:      
 
Domain Number 2 Region: 438-532
Classification Level Classification E-value
Superfamily EF-hand 4.99e-36
Family EF-hand modules in multidomain proteins 0.0000366
Further Details:      
 
Domain Number 3 Region: 514-601
Classification Level Classification E-value
Superfamily RING/U-box 4.83e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 149-270
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000677
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 5 Region: 273-310
Classification Level Classification E-value
Superfamily WW domain 0.0000000000237
Family WW domain 0.00023
Further Details:      
 
Domain Number 6 Region: 6-76
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000432
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005299   Gene: ENSGMOG00000004989   Transcript: ENSGMOT00000005459
Sequence length 855
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3590:1261172:1333825:-1 gene:ENSGMOG00000004989 transcript:ENSGMOT00000005459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKHHPADMNLCWNEIKRKSHNIRVRLEAFSDNSGKLQLSLQEIVEWLTSKDEELSQQLPI
GGDVSAVQHQAEFHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSPR
RRVLNVSRSVWKQASVTSDLWEKLTARCVDRHRHMERTLERLLQTQAAMEELDVALEQAE
GVRDAWEPVGDLFIDALQDHIDATKLFKEELSQVKEGMKHVNDLAHQLAISDVHLSVDNA
RALEHLNSRWKLLQGSIEERLKQLQDAHRDFGPGSQHFLCSSVQVPWERAISPNKVPYYI
NHQAQTTCWDHPKMTELYQALVADLNNIKFSAYRTAMKLRRVQKALRLDLVALGSLAEVF
REQDLQQGEHVMDVVEVIHSLTALYERLEEERAVAVNIPLCVDMCLNWLLNVYDSGRNGK
MRVLSFKAGLVSLCKADVKEKYKYLFRQVCGPGGQTDQRHLSLLLHEAIQVPRQLGEVAA
FGGSNVEPSVQSCLRMAPGKPAIEVSHFLEWMSLEPQSMVWLPVLHRVAAAESAKHQAKC
YVCKQCPIKGFRYRSLKQFNVDICQTCFLTGRTSKGNKLHYPIMEYYTPTTSGEKMRDFA
KTLKNKFRSKQYFSKHPQRGYLPVQSVLEAESAETPCSSPKLPHADTHSRIEHFASRLAE
MENQTCSFFTDSLSPDESLDEDQYILRHSSPALEQDSPCGQHLLLVHLEHQDREQLQCTL
ARLENENRVLQSEYRRLQWRHEEAASVPMLTEAGEGGVLCSPTADGGPQEDEELLAEARV
LRQHKTRLETRMQILEDHNKQLDSQLRRLRELLLQQPKEDSEANGSEPSTLSSPVSRGDR
HGEGASRETTDTEAA
Download sequence
Identical sequences ENSGMOP00000005299 ENSGMOP00000005299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]