SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005344 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005344
Domain Number 1 Region: 59-118
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000363
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 6-42
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000161
Family I set domains 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005344   Gene: ENSGMOG00000005059   Transcript: ENSGMOT00000005504
Sequence length 119
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4635:3190:11303:1 gene:ENSGMOG00000005059 transcript:ENSGMOT00000005504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVGDGGTSLTILNVTRYDRGPYTCNVSNPVSNDVGRPLTLTIGCEFPCPSCNMSIVGPRE
AALGIRVLLRCSADSVPPPTYRWALDGNDTRVTTSTYVVERMEESHAGNYTCTVNNRVT
Download sequence
Identical sequences ENSGMOP00000005344 ENSGMOP00000005344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]