SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005538 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005538
Domain Number 1 Region: 112-613
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.62e-157
Family Calponin-homology domain, CH-domain 0.00000000273
Further Details:      
 
Domain Number 2 Region: 4-84
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000031
Family Calmodulin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005538   Gene: ENSGMOG00000005215   Transcript: ENSGMOT00000005704
Sequence length 619
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2286:11780:19411:-1 gene:ENSGMOG00000005215 transcript:ENSGMOT00000005704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPAPISAEEQEELREAFAKIDMDNNGFICKNELHELFKAANLPLPGYRIREMVQELMK
TSEQLTFDQFAEIVQGLKSTEVANTFRKAINKKEGINAIAGTSEQSGTQHSYSEEEKVAF
VNWVNMALEKDPDCKHLLPMDPSSNQLFTAVGDGILLCKMINLSVPDTIDERTINKKKLT
PFTIQENLNLALNSASAIGCHVVNIGAVDLKEGRQHLVLGLLWQVIKIGLFADIEITRNE
ALMALLQDGESLEDLMKLSPEELLLRWANYHLAEAGCPKINNFSSDIKNSQAYYSLLNQV
APKGDEDGVPAIPIDMTGLREKEDLKRAECMLEQADRLGCRQFVTATDVVRGNPKLNLAY
VANLFNKYPALKKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYVDIDDAMVI
FQLYEKIKVPVDWERVNKPPYSRLGGNMKKLENCNYAVELGKKEAKFSLVGIAGQDLNSG
NRKLTLALLWQLMRRYTLNILEDLGDGQKVTDDTIVSWVNQTLSEAGKPTISSFKDGSIS
NSMPVLNLIDAIQPGSIRYDLLKMEDLTEEEKLNNAKYAISMARKIGARVYALPEDLVEV
KPKMVMTVFACLMARGMKK
Download sequence
Identical sequences ENSGMOP00000005538 ENSGMOP00000005538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]