SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005658 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005658
Domain Number 1 Region: 30-290
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.93e-72
Family PAPS sulfotransferase 0.0000000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005658   Gene: ENSGMOG00000005346   Transcript: ENSGMOT00000005825
Sequence length 290
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3006:20702:22002:-1 gene:ENSGMOG00000005346 transcript:ENSGMOT00000005825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFWTVVFALLFLLLETQLCLCLRELRNGGSNHTQQRLPGAIIIGVRKGGTRALLEMLNLH
PDVDVAKAEVHYFNVEEHYQQGLDWYRAQMPFTQAGQLTVEKTPGYFASTQVPARVWDMN
PAVRLLLIVRDPAERLVSDYTQVRHNRLERHKPYQALEEMLLHQGDINPEYKALQRSLYH
QHLARWLEVFPREQIHIVDGDALIRDPYPELQKAERFLGLPARISPSNFYYNSTKGFYCL
LSAGHDKCLDESKGRPHAPLSAQAFRKLCHYFRKPNRVFFGMVGRSFSWC
Download sequence
Identical sequences ENSGMOP00000005658 ENSGMOP00000005658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]