SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005778 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005778
Domain Number 1 Region: 543-739
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-47
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 802-994
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.23e-41
Family BAR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 226-283
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 1293-1353
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-16
Family SH3-domain 0.00018
Further Details:      
 
Domain Number 5 Region: 1060-1139
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000223
Family SH3-domain 0.0000211
Further Details:      
 
Domain Number 6 Region: 4-63
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000236
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 7 Region: 150-215
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000919
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005778   Gene: ENSGMOG00000005405   Transcript: ENSGMOT00000005947
Sequence length 1357
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1375:10571:47032:1 gene:ENSGMOG00000005405 transcript:ENSGMOT00000005947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVGSVVRAVFEFLPSVSEELPLFAGDVIEVLSVVDEFWLLGNKDGVTGQFPSTFVEAVP
IPSTKAGDRLYVCINDFTSSEPGTLALKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXAQAQAADLPPHALGQARALMSLHAQLHEELDFRQGDLIV
ITGVPEPGWFRGELRGHRGVFPEGFVELVGQLRSPRDRREDEEDGGVYGVALYDFRAMEA
GELDFDVGDRVRVVNTLEDGWLEGEVKGRRGVFPHRFVKMEDNGLAAAVEADAAWRRRGX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXNGGRREAEKEERRREEEEEYRLLLRIQEVERDMEEYAHTADELRAMLEE
EEEEKARLQAMENLEFCNYTLETLTLELQQLQEMTLLSAERKSLDSSPLSDTAPATASAA
EDPELRMMEKREKVVEELLQTEKDYIKDLQMCVSEIVEPLQRKQVQNVDYDGLFGNIGSV
IDLSQRLFRELEETDSIGKVFLDFKSELEDVYKIYCQNHDDAIALLGTYEKDESIQRHVL
ECLEKLXXXXXXXGKTNYINLGSFLIKPVQRVMRYPLLLMELLGATPEGHHDHAQLSLAL
LAVKEINVNINEYKRRKDLGXXXXXXXXXXXXXXXXXXXXXXXXMKYRKGDEDTLIDKIS
KLSMHSIIKKSNRVSSHIKHLTGMSPQVKDEAFDEAEKRFRLQERLIKSFIRDISLYLQH
IRESASVKVLAAISFCDIYTDRSFMDPECFQRAHRSISDKQFTHFKERTEALVTGPLNQL
LLMFAGPHKLIQKRFDKLLDYDGCKERAERMKERRAQEELRAARNNYEALNAQLLDELPK
FHTAAEELLTGCVRAFARAQKDFVKRTLGELKPSLSTEGNLVSVFQEEYTRVLKLLQSFS
FCPENLPASSSTRKTFDKKPMEKQNSKKQLQGPPNYIPQTDEQRSGLLARYTPEKLFRAE
RNFNAAQDLDMSVMEGDLVGVIKQQDPMGSNNRWLIDNGEGFVYSSFLKPYNPRRSHSDV
SIESQSSNESGYGGSSPVFSRQNSTSTLTFNQEAATVSFSAAQPSPQPSIDSASXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYYALYSFSARCANELTIAAHERV
RILEFHDMNGNGEWWLGEAGGRRGYVPSNYIRKSEYT
Download sequence
Identical sequences ENSGMOP00000005778 ENSGMOP00000005778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]