SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005811 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005811
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000345
Family I set domains 0.02
Further Details:      
 
Domain Number 2 Region: 182-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000348
Family I set domains 0.039
Further Details:      
 
Domain Number 3 Region: 136-195
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000229
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005811   Gene: ENSGMOG00000005471   Transcript: ENSGMOT00000005983
Sequence length 367
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3954:23292:30488:1 gene:ENSGMOG00000005471 transcript:ENSGMOT00000005983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGFIKSPMSEVKLTGDTFELYCDVVGNPTPEIQWWYAEINRADSFRQLWDGARKRRVSIN
TAYGANAVSVLGVTRLGLDDSGTYECRASNDPRRNDLHQNPATTWIRAQATITVLQKPTI
ASSEHTTLPSDSHSPPITLQCNLSSAHGAHEESFWMKNGEEIEETRTANRNTEYKLVKPR
GDDAASYMCVYTFETAPPANATIEVAPDITGHKRSENKNEGQRAVLYCKSVGFPYPNWTW
RKLDSGAFMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEPAGPMKTNSTNNHKDKN
LRQRNTN
Download sequence
Identical sequences ENSGMOP00000005811 ENSGMOP00000005811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]