SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005880 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005880
Domain Number 1 Region: 25-166
Classification Level Classification E-value
Superfamily EF-hand 4.15e-31
Family Calmodulin-like 0.00000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005880   Gene: ENSGMOG00000005541   Transcript: ENSGMOT00000006054
Sequence length 173
Comment pep:novel genescaffold:gadMor1:GeneScaffold_672:35611:38425:-1 gene:ENSGMOG00000005541 transcript:ENSGMOT00000006054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKAKRRQQQGEGGGSSNVFSMFEQSQIQEYKEAFTIIDQNRDGIISKDDLRDVLATM
GQLNVKNEELEAMVKEASGPINFTVFLTMFGEKLKGADPEDVIVSAFKVLDPEVTGSIKK
EMIEELLTTQCDRFTAEEMTNLWAAFPPDVAGNVDYKNICYVITHGEDKEEEE
Download sequence
Identical sequences ENSGMOP00000005880 ENSGMOP00000005880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]