SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005925 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005925
Domain Number 1 Region: 94-201
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-24
Family PDZ domain 0.0035
Further Details:      
 
Domain Number 2 Region: 229-320
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-21
Family PDZ domain 0.0000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005925   Gene: ENSGMOG00000005580   Transcript: ENSGMOT00000006098
Sequence length 334
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1692:69991:88921:1 gene:ENSGMOG00000005580 transcript:ENSGMOT00000006098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAQEVFRKAMRSPLVRLEVVPSSNRERYEKHLIGQLFGSACHEGSPFTARSKEPLPPVKT
KPAFKPTDHPANLLAEEAVASKGRCESPLLRKSPALGNLVTNKKGGKRLRIDLKKGVEGL
GFTVVTRDSSVHGPGPILVKNILPRGAAVKDGRLQSGDRILEVNGVDIAGVGQEELVCML
RSTRQGECVCLGVLRQDEMFLPRELXXXXXXXXXXXXXXXXXKEEPLRPPSSEDGKEELM
LEVALNESGSAGLGVSLKGNKSRHTGADLGIFIKSIIHGGAAYKDGRLRVNDQLVGVNGA
SLLGRSNHVAMETLRRSMSQEGNLRGTTTGGAES
Download sequence
Identical sequences ENSGMOP00000005925 ENSGMOP00000005925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]