SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006000 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006000
Domain Number 1 Region: 1668-1929
Classification Level Classification E-value
Superfamily SAICAR synthase-like 9.15e-62
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0032
Further Details:      
 
Domain Number 2 Region: 690-856
Classification Level Classification E-value
Superfamily GroEL apical domain-like 3.92e-40
Family Group II chaperonin (CCT, TRIC), apical domain 0.0004
Further Details:      
 
Domain Number 3 Region: 367-496
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.56e-29
Family DEP domain 0.0032
Further Details:      
 
Domain Number 4 Region: 159-229
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.15e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000006000
Domain Number - Region: 645-696,849-869
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.000732
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.068
Further Details:      
 
Domain Number - Region: 1319-1419
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00475
Family Spectrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006000   Gene: ENSGMOG00000005571   Transcript: ENSGMOT00000006175
Sequence length 1943
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1683:133503:166506:1 gene:ENSGMOG00000005571 transcript:ENSGMOT00000006175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADDKSSSSSSTDWTAEQPVLSPSSPSHLTQFKPLTPEQDEPPLRSAYSSFVNLFRFSN
KEEGRAPSPTILEKADVPVPSPQLVRGPWATSPSHSNHLPGSHRKQHPDPLRRTSTGRRK
SETPLSSHDPRTAVQLRTALKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCNEKFTTFR
RRHHCRLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSADSGSIGEDLSA
LSDSPCSVSVEPSEPRTPVGGRKASRNIFLEEDLTWQSLIHQETQGSGLSSRLTTLQEDV
GKSPARKRSASVSNLSLDRAGSAMGPAYDSSVSPQPSRTMSNAKAGPMTGTKQDHSEEER
KILLDSSQLKDLWKRICHHNTGMEFQDHRYWLRTYPNCIVGKELVNWLLRNGTISTRAQA
IAIGQALVDGRWLDCVTHNDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSLEGHSEPSW
FKDIKFDDSDTEQLADESDCTMPNSSSPSKRTSVSSVQSAVDSDSAASINLNVEQDNVNF
HIKRQSKYPHVATEKVKAELLLSEDGGQNISISDAFIKESLFNRRVEDKAKDLLLTPLGW
HHSSLDQLREENGEKKAMERLLSANHSHMMALLQQLLYSESLSLSWRDVIVPVVRTVVQT
VRPDVRSCDDDMDIRQLVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMNSYIKNPKVLLL
KCSIEYLYREETKFTCIDPIVLQEREFLKNYVQRIVDVRPNLVLVEKTVSRIAQDMLLEH
GITLVINVKPQVLDRVSRMTQGDLVMSMDQLLTKPRLGTCHKFYMQPFTLSNNESKTLMF
FEGCPAHLGCTIKLRGAAEYELARVKEILMLMVCVAYHSQLEISFLMDEFAMPPSLAPST
SFPCLLEGSPATRRFRDPLQDDTGMFVAEQVASCDDRLKSLSTAFRQELKDIILCISPFI
GFREPFLLTAAGLQCPSRDYFPEQVYLSPLLNKDLKELDGRRKRQLLKDPAPSAPPTPRA
SAALQRPLDVLPSHRLTSARMVEQVNGSSGLARMLADYXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDCFNPVNHQRLCVLFSSSSAQSNN
APNPCVSPWIVTMEFYGKNDLSLGVFLERYCFRPSYQCPSMFCETPMVHHVRRFVHGGGC
VQIVLKELDSPVPGYQHTILTYSWCRICKQVTPVVPLSNESWSMSFAKYLELRFYGHQYT
RRANAEPCGHSIHKDYHQYFSYNQMVASFSYIPVRLLEICLPPPKILIRNQGPSKNLMQQ
DLKDFFLKVSQVYLAIDDRLTSLKTDTFSKTREEKMEDLFAQKDMEEAELRSWIEKLQAR
LQSCCPDSPQQLQAVLESVVIRKQSLCETLQSWNSRLQDLFQQEKGRKRLSVPPSPGRHR
QTNAEDSKGVLEPSTRNISPVVSNGDKAVRHVTHCLLAEDRHLSTLQSPGDLAMTRSTPP
SFPEQDSGSISEDVFDGHLLGSNDSQVKEKSTMKAILATFLPGNSYNSIPFPFEPDKHYL
MYEHERVPIAVCEKEPSSIIAFALSCKEYKTALDDISKIAKTGLDDASQSIRKHMVPDEL
LGSLLLVFLSGGGGGAESRSRSSPAKPNESNLSQLGRSSLDSEPLNGLTLNTFSDANAKF
YCRIYYAEEFHKMREEIMESSEDDFVRSLSHCINWQARGGKSSRPRLEVQSFLDFAPHYF
TYITGAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGS
LRNRNVKTDLGKESCEVVLLDENLLKLVHDNPLYIRAHCKAILRAAIHSDAYFLSSHLII
DYSLLVGRDDTTDQLVVGIIDYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRAR
FCEAMDKYFLMVPDHWNGLGINC
Download sequence
Identical sequences ENSGMOP00000006000 ENSGMOP00000006000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]