SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006012 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006012
Domain Number 1 Region: 598-667
Classification Level Classification E-value
Superfamily EF-hand 0.000000408
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 352-409,447-571
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000165
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000006012
Domain Number - Region: 657-728
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0785
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006012   Gene: ENSGMOG00000005641   Transcript: ENSGMOT00000006187
Sequence length 747
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1406:127634:132358:-1 gene:ENSGMOG00000005641 transcript:ENSGMOT00000006187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AESHLSGQVECELERVGPGAWVNQGYHGTPPPPPRAVSTIYDPQPLYPSLGPLEGARGMP
EPAPELVQDPQRKKRRGCCSFVKGLWGTTLTEDNSDNREQFMRTTLRELLVYLVFLVDIC
LLTYGMTSSSTYYYTKAMTDLFVSTSGDGGVAFQSIDSMSDFWIYAKGPLLDGLYWTKWY
NNQPLASGERSFIYYENMLLGVPRMRQIKIKDNSCKVHSDFQDEIKGCFDVYNEIKEDDQ
GSRDINGTAWTYHTEKEINGSAHWGLLTSYSGAGFYQDLNTTKAESAAVVGELKENLWLD
RGTRAVFVDFSTYNANINMFCVIRLLVEFPASGGAIPSYQIRTVKLIRYITYWDYFILGC
ECVFCLFILYYIVEEILELRIHKCSYFKSVWNILDVVIIMLAIVAVVFNVFRTIKVDKLL
GKLLQQPDIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLGRCAK
DILGFAVMFFIVFFAYAQLGYLLFGTEVDSFSTFVKCMFTQLRIILGDFDYNAIERANRV
LGPIYFFTYVFFVFFVLLNMFLAIINDTYSEVKEELSLQKDDLQITDLIKQSYMKTFMKL
KLKKEKISDVHKALRSKSGEIEFKDFRETLKEMGHADHEISAAFSRFDYDGNQVLDREEQ
ERMKAELEEKREALSAELNQLGRDYDKGSEEETSLNTAQKETSNQTTVEHREIQRLSRQV
VQLESSISAIVPQIDMIMKKLGFKTVR
Download sequence
Identical sequences ENSGMOP00000006012 ENSGMOP00000006012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]