SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006051 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006051
Domain Number 1 Region: 195-334
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-44
Family Third domain of FERM 0.000000215
Further Details:      
 
Domain Number 2 Region: 85-194
Classification Level Classification E-value
Superfamily Second domain of FERM 1.27e-36
Family Second domain of FERM 0.0000011
Further Details:      
 
Domain Number 3 Region: 495-572
Classification Level Classification E-value
Superfamily Moesin tail domain 2.48e-30
Family Moesin tail domain 0.0000215
Further Details:      
 
Domain Number 4 Region: 2-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-25
Family First domain of FERM 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006051   Gene: ENSGMOG00000005687   Transcript: ENSGMOT00000006226
Sequence length 572
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2253:6252:49844:1 gene:ENSGMOG00000005687 transcript:ENSGMOT00000006226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYTDSKSYITWLKLNKK
VTQQDVRKENPLQFKFRAKFYPEDVSEELIQEITQKLFFLQVKEAILNDENYCPPETAVL
LASYSVQAKYGDYSKEGHKPGYLTHDRLLPQRVLEQHKLTKEQWEDRIQTWHEEHRGMLR
EDSMMEYLKITQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSE
IRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQ
MKAQARDEKQQKQMERAQLENEKKKREHAEKEKDRIEREKDELLERLRTIEEQTLRAQRE
LEEQTRRALELEAERKRAREEAERLERERQAAEEAKAELARQAADQMKNQEQLATELADL
TSKISILEDAKKKKDEEAQQWQDKAELVQEDLEKTKDELRTKMAAQIQEPVNEENEHDEN
DESNAEASAEFAGGASDRSEEERMTEADKNERVQKHLLALSSELAVARDETKKTVNDVIH
AENVRAGRDKYKTLRQIRSGNTKQRIDEFECM
Download sequence
Identical sequences ENSGMOP00000006051 ENSGMOP00000006051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]