SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006414 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006414
Domain Number 1 Region: 16-112,147-248
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.25e-60
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006414   Gene: ENSGMOG00000006047   Transcript: ENSGMOT00000006604
Sequence length 249
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2546:17589:23897:1 gene:ENSGMOG00000006047 transcript:ENSGMOT00000006604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLPLACSQCDPPTEVQDLFRDIQDGRVLMALLEELSGCQLLHGFKKSSHRIFRLNNIAK
VLTFLEERNVKLVSIDASDIADGNSSIILGLIWNIILFFQIKELTGNIRSQFPSTSSLSS
IPTSSDSDTSHSSTPSSAGGPPAPGTRPGRAIKKLLQWVQKRTRKYGVAVQDFGKSWTSG
LAFLAVIKSIDPSLVDMRRALLRTPRENLEEAFRTAHYTLGIPRLLEPEDVIISRPEEQC
IMTYVSQFL
Download sequence
Identical sequences ENSGMOP00000006414 ENSGMOP00000006414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]