SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006593 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006593
Domain Number 1 Region: 8-110
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-23
Family Third domain of FERM 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006593   Gene: ENSGMOG00000006146   Transcript: ENSGMOT00000006786
Sequence length 180
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1376:36699:39033:1 gene:ENSGMOG00000006146 transcript:ENSGMOT00000006786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGQNSFPRLTPKIGFAWSEIRSISSKDKKFIIKPIDWKAPDFVFYAPRLRVNRCILQLCT
GNHELYMRRRKPDTIEVQQMKAQAKEEKLQKKIERDNLEGEKRKQAANEKKKKAEMERET
RDLKIRLSQYEETTKKITQHLQEQLERGLRLEEERRRVEQEAARLETERMEAIIAKEELL
Download sequence
Identical sequences ENSGMOP00000006593 ENSGMOP00000006593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]