SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006756 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006756
Domain Number 1 Region: 255-373
Classification Level Classification E-value
Superfamily FKBP-like 1.28e-34
Family FKBP immunophilin/proline isomerase 0.0003
Further Details:      
 
Domain Number 2 Region: 138-258
Classification Level Classification E-value
Superfamily FKBP-like 3.34e-34
Family FKBP immunophilin/proline isomerase 0.00066
Further Details:      
 
Domain Number 3 Region: 34-136
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-33
Family FKBP immunophilin/proline isomerase 0.00025
Further Details:      
 
Domain Number 4 Region: 358-466
Classification Level Classification E-value
Superfamily FKBP-like 1.83e-26
Family FKBP immunophilin/proline isomerase 0.00094
Further Details:      
 
Domain Number 5 Region: 479-546
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000972
Family Calmodulin-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006756   Gene: ENSGMOG00000006353   Transcript: ENSGMOT00000006951
Sequence length 562
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1316:12677:19787:-1 gene:ENSGMOG00000006353 transcript:ENSGMOT00000006951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAVCVLILVLNALFCVECNPSPVGDVVVERYSTGCAREVKNGDHVRYHYNVTLLDGKTF
DSSHQKGVPKVGLIGEGRLIAGIEKGIVGMCINERRKVTVPSHLAYGAAGAGDVVPPDAT
LVFDLHLLDLWNNADMVVTKTISTPKDCRRSIMRTDFARYHFNGTLLDGTLFDSSYAREQ
THDSLVGEGWLIKGLDEGLLGMCVGEIRTVVIPPFKGYGEKGLGQEVPSQATLIYSILLV
DIHNAKDNITVENQVVPESCTRKSVVGDYMRYHYNGTFLNGVTFDTSYQRNTTYNTYIGM
GYVITGMDQGLLDVCVGETRRVIIPPHLAYGEQGAGKDIPGSAVLVFDVDIIDFHNPKDN
ITVEIISKPEICNETSDANDLIHYHYNCSLMDGTLLFAYENHQEALLGADKVIDGLDQGL
RGMCVGEKRVVTVPPHLGHGEKGATGVPGSAVLVFELELIDLAKGVPPGYLFVWLGESPQ
ELFDSLDMNKNKEVPEEEFGEFIKLQVAEGKGRMKPGMDPEEIIADMFKNQDRNHDGLIT
PDELKLKVEEDQEREAAQHTEL
Download sequence
Identical sequences ENSGMOP00000006756 ENSGMOP00000006756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]