SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006801 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000006801
Domain Number - Region: 22-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0322
Family Ubiquitin-related 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006801   Gene: ENSGMOG00000006405   Transcript: ENSGMOT00000006999
Sequence length 129
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3483:193450:194747:1 gene:ENSGMOG00000006405 transcript:ENSGMOT00000006999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCVHYKFSSKLDYNTVTFDGLHITLNELKRQIMARERLKATDCDLQITNAQTREEYTDD
EIHIPKHSSVIVRRTPIGGVKPAGRTFIIDRSDTAMVGSSRPVCKPTTPITPLENILSGI
CIVEFVKGK
Download sequence
Identical sequences ENSGMOP00000006801 ENSGMOP00000006801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]