SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006933 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006933
Domain Number 1 Region: 5-222
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-58
Family DBL homology domain (DH-domain) 0.0000194
Further Details:      
 
Domain Number 2 Region: 208-353
Classification Level Classification E-value
Superfamily PH domain-like 5.36e-33
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 
Domain Number 3 Region: 370-484
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-30
Family DEP domain 0.0031
Further Details:      
 
Domain Number 4 Region: 469-599
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.41e-28
Family DEP domain 0.0017
Further Details:      
 
Domain Number 5 Region: 652-733
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000112
Family PDZ domain 0.033
Further Details:      
 
Domain Number 6 Region: 587-666
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000852
Family PDZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006933   Gene: ENSGMOG00000006488   Transcript: ENSGMOT00000007133
Sequence length 1599
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1041:64093:171757:1 gene:ENSGMOG00000006488 transcript:ENSGMOT00000007133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASSKESDRQQRLRLCVLNEILNTERAYVRTLLFLQSAFLQRIRQTSEDQQCLTPEQVKVL
FSNMEDILDLHRALLSMLESCLQPEPHPQHALGHVFLLYKGKFSVYGEYCSNHEKALKML
MELNKVPNIRTFLLHCMLLGGKKSTDIPLEGYLLNPIQRICKYPLLLKELLKRTPKKHVD
YPAVEEALQTMKAVCSNINETKRQMEKLEALEQLQSHIEGWEGTNLTDISTELLLHGNLL
KISAGNIQERVFFLFDNLLVYCKRKSRVSGKKSTKRTKSLSGPLYVFRGRINTEVMEVEN
VEDGTADYHSNNYTVTNGWKIHNTAKNKWFVCMAKNTEDKQKWLDAILREREQRESLKLG
MERDAYVMIAEKGEKLYHMMMSKSRHLIKDRRRKLSNVPKCFMGNEFVSWLLESGEISKP
DEGVNLGQALLENGIIHHVSDKHQFKNEQVLYRFRYDDGTYKARSEMEDIMSKGVRLYCR
MHSLHTPVIKDRDHHLKTFRSVVPAYKLVDWLLSQGDCSTREDAVMLGVGLCNNGFMHHV
LEKSEFKDESQFFRFYADEEAEGTGTKSKQLQRNDFKLMENILAKSLVIHPEEEDYGFEI
EEKSKSIVVKSVTKGSHAEMAGLQVGRKIFTINEDLLLLRPFPEVETMVNASFCIRRSLR
LLVATKAKEILKIPDHPEMLAFRLCGSSPPHVHAVRKGSEAAGAGLQPGQVILKVNGSSV
NHSDHQEVLDHFSAQXXXXXXXXXCQWVYRAFEDVEPQGRCTAPAERRTPEPTGQVLHQP
PLGEEPPPVSLTVDNVHLEQGVVYEYVSTAGIKSHVLEKMVEPKGCFSLTAKILEAFGRD
DSRFVRNCSALISQSERVVTMSQYEFRQICDTKLESLQRRITNYQQFAEELRNKAWPSVK
PASVHVAGVPGHPLGCMDFVPTNLHVNLMQVSYAKSAATSTGRAFSIRFGRKNSFYGLDP
DQANLNPMSHTQHCVTSMGAPAWNCTAPVDGEEGPGEGGLSFLLKQEDVETQDAYVRLYS
RLDAAVREMRQYVAQIDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCCEEGGDPDRTE
HGGIKRVCFKVEEEEQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGS
GDELPWDMRIPSDKQDKLHGCLEHLFNQVDSINSLLKGPVMTKACEETKHFHPDHSQPEF
RHTEDWTVRCRCVIHKNIQEDPWNLPSSIRTLVDSLQRFVEDGKNQLLLALLKCTDTSLQ
LRRDVIFCQAAGARCTLAEQLLAALRARYNNAGEYQEDSKETSRKWLEQVSAIGVLLHFQ
SSLAPHLKEERTMLEDTKAALLDLDKLTVFFKQTQNEYLVPNTPVSYQVDGGRQALRVTL
LLDSCHFSELPSRLQNGGSLKLHTVLFTRALERPECSSQQDFVAMEEFQQRTNAVSLERV
KAYYRKLRAFYLEKSNLQTDSNTTAMKIDQLLRPLNALDDLCRLMQSYVNVRPSAGGHPS
GVSVLSVSSELCNRLGACHVTMCATGMQRCTLSVTLEQAMILARNHGLIPRCIMQTMDIM
RKQGTRVELFAKNLKVMDQMPPSAPRLFRLCLPPSDGDL
Download sequence
Identical sequences ENSGMOP00000006933 ENSGMOP00000006933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]