SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006974 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006974
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily EF-hand 5.05e-52
Family Calmodulin-like 0.0000000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006974   Gene: ENSGMOG00000006562   Transcript: ENSGMOT00000007175
Sequence length 190
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2102:1312696:1325221:-1 gene:ENSGMOG00000006562 transcript:ENSGMOT00000007175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKSNSKLKPEVVEELTRKTYFTEKEVQQRYKGFIKDCPSGQLDAVGFQKIYKQFFPFGD
PTKFASFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRDE
MLNIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIV
QALSLYDGLV
Download sequence
Identical sequences ENSGMOP00000006974 ENSGMOP00000006974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]