SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007001 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007001
Domain Number 1 Region: 3972-4207
Classification Level Classification E-value
Superfamily Plakin repeat 1.31e-85
Family Plakin repeat 0.0000000385
Further Details:      
 
Domain Number 2 Region: 166-394
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.48e-84
Family Calponin-homology domain, CH-domain 0.00000127
Further Details:      
 
Domain Number 3 Region: 3067-3307
Classification Level Classification E-value
Superfamily Plakin repeat 3.14e-80
Family Plakin repeat 0.000000292
Further Details:      
 
Domain Number 4 Region: 3398-3637
Classification Level Classification E-value
Superfamily Plakin repeat 3.4e-77
Family Plakin repeat 0.000000267
Further Details:      
 
Domain Number 5 Region: 2741-2980
Classification Level Classification E-value
Superfamily Plakin repeat 3.79e-75
Family Plakin repeat 0.000000336
Further Details:      
 
Domain Number 6 Region: 3736-3957
Classification Level Classification E-value
Superfamily Plakin repeat 7.15e-69
Family Plakin repeat 0.000000634
Further Details:      
 
Domain Number 7 Region: 4283-4324,4365-4559
Classification Level Classification E-value
Superfamily Plakin repeat 1.22e-67
Family Plakin repeat 0.000000351
Further Details:      
 
Domain Number 8 Region: 408-522
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-23
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 9 Region: 1297-1467
Classification Level Classification E-value
Superfamily Spectrin repeat 6.88e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 10 Region: 714-843
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000156
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 11 Region: 801-928
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000216
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 12 Region: 4230-4278
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000628
Family Plakin repeat 0.0079
Further Details:      
 
Domain Number 13 Region: 580-746
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000016
Family Spectrin repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000007001
Domain Number - Region: 1231-1334
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000677
Family Spectrin repeat 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007001   Gene: ENSGMOG00000006545   Transcript: ENSGMOT00000007203
Sequence length 4626
Comment pep:novel genescaffold:gadMor1:GeneScaffold_293:1624746:1686877:1 gene:ENSGMOG00000006545 transcript:ENSGMOT00000007203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGMVMPLRDLRAIYELLFRDGVMVAKKDKRPQTKHPEIPGISNLQVMRAMLSLKSRGY
VKETYSWRHFYWYLSNEGIVYLRDYLRLPAEIVPASLQRVKRPAAMLPISRRGAQVQTVE
GPTSYVPKPGGRPGSESREGLAERQGYRHKMAEGEEXXXXXXXXXXXXXAQDERDRVQKK
TFTKWVNKHLMKSQRHVSDLYEDLRDGHNLISLLEVLSGEHLPREKGRMRFHKLQNVQIA
LDFLRLRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQQISDIQVNGQSEDMTAKEKLL
LWSKTMTENYQGMRCDNFTTSWRDGKLFNAVIHRHQPRLVDMGRVYRQTNLENLEQAFNV
AEKDLGVTRLLDPEDVDVAHPDEKSIITYVSSLYDAMPRIPEAQEGQLELRWQEYYELVT
LLLQWIQHHITIFGERKFPGSYEEIEILWRQFLKFKETELPAKELDKNRSNQIYQTFESA
VRAGQVKVPPGYHPIDVEKEWGRLHSACLDREKLLRIEFERLERLQRIVTKVQMESGVCE
EQLNQLDSQMQTDLRLLNSGKPARYTAEVERDLDKADGMIRLLFNDVQFLKDGRHLQSEQ
IYRRVYRLHERLVNLRTDHNLRQKTTLTTTMHQIAQVSQSSKGRPELDGVTLRYAQDLLA
WVEENQRRINESEWGSDLPTVESNLGSHRGLHQSVEDFRAKIERAKTDEGQLSPVSKGAY
RDYLGKLELQYAKLLNSSKSRLRNLESLNGFVSATTKELMWLNDKEEEEVNFDWSDRNSN
MTAKKDNYSGLMRELELREKKINDIQTTGDKLIREGHPGKKTVEAFTAALQTQWSWILQL
CCCIEAHQKENTSYYQFFADVKESQEQMRKMQENMKKKYSCDRATTATRLEDLLQDAAEE
KEQLNEVKTNVSSLNKRARTIIQLKPRNPTTAIKGKLPIQAVCDFKQAEITVHKGDECAL
LNNSAPFKWKILNRSGNEAVVPSVCFMVPPVNKDAMDSVASLDAGHQQMVTMWQQMHIDM
KGLLSWQYLMKDITVIRSWNITMFKSMKQDEYRLMIRNLQLHYQDFLRDSQDSQQFGPDD
RQQVEGEYNKTTQYFDNLLSSMEKGEQYESVCKSYTSQLKDLRVRIEDCETHTVNRIRRP
LGEEPLKECLLKTSEQKKEHNELDRIKKEVDTVSLKTQEVLSSPQQPASAPALRSELQVT
VQKMDHAHMLSSVYLEKLKTVDVVIRSSQGAEGVLKKYEDKLRDVQTVPNDVKEVETCRA
ELKKLHAAAESEQPAFESLETELKKASGASDRMSRVHSERDVELDHYHRHLSGLQDRWRA
VFTQMDLRHRELEQLGRQLGYYRESYAWLIQWIGDAKQRQEKIQAVSISDSKTLKEQLAQ
EKKLLEEIENNKDKVDECHNYAKAYIDTIKDYELQLVAYKAQVEPFTSPMKKNKMDSASD
NIIQEYVTLRTRYSELMTLTSQYIKFITDTQRRLEDEEKAAQKHKVEEQKKFAEIQAELA
KQKQLAESHAKAIAKAEQEALELKLKMQEEVSRRDIVAVDAQNQKQNIQQELHELKNLSE
QQIKNKSQQVDEALYSRTKIEEEIRIIRIQLETTVKQKSVAESELHQLRDKAEEAERLRK
AAQEEAEKLRIQVNEETHKKRAAEEELKLKSEAEKEAAKQKQRALEDLENLKMQAEEAVQ
QMKQAEIEKERQIKVAHQAAQKSAAAELQSKRMSYVEKTTKLEESLKQEHGTVLQLQQDA
ARLKKQQEDAESAREEAEKELEKWRQKANEALRLRLQAEEEAQKKTVTQEEAEKQKEEAE
REAKRRAKAEESALKQKEMAENELERQRKLAEGTAEQKLNAEQELIRLRADFDHAEQQRS
LLDNELYRLKNEVVAAQQQRKQLEDELAKVRSEMDLLIESKNKAEKESMSKTEKSKQLLE
NEAAKMKDLAEEAGKLRSIVEEAKRQRQVAEDEAARQRGEAERILKEKLAAINEATRSKT
EAEIALKEKEAENERLRRHAEDEAYQRKALEDQANQHKQDIELKIVQLKKSSEVEMERQK
AIVDDTLKQRRIVEEEIRILKVNFEKASSGKLDLELELNKLKNIAEETQQSRLRAEEEAE
KLRKLSLKKIAAAEAEAGRQRKIAQDEVERLKKRAEEARKQKEEADMEAEKQIVVAQQAA
QKCSAAEHQVQSVLEQQQEDNIGQQKLKAEYEKAKKLAKEAEAARKNAENEAALLRQQAE
EAERQKLLAEQEALVQQKAQEDAERLRKEAEFEAAKRGQAEAAALKQKERADAEMAKHKK
LAEQTLKQKFQVEQELTKVKLQLDETDKQKYVLDDELQRLKDEVGDAVKQKAQVEEELFK
VKVHMEELLKQKLRIEGENQRLIKKENENTQKFLADKAENMKKLSEEAARLSVEAQEAAH
LRQAAEDELSQQRALAEKMLKEKMQAIQEASTLKAEAEMLQRQKDQAEEQAQKLLKDKQL
MQQRLEEETEGYQKSLEAERRRKLEIIAEAEKLKLEVSQLSDGQSKAQEEAKKFKKQADS
IAARLHEIEIKNLEVQQFSSKESGDLRKAFADLENEKDKLKKEAEELQNKSKEISDAQQK
QIEHEKTMLQQSFLSEKEMLLKKEKLIEDEKKKLESQFEEEVKKAKALQDEQERQRQLME
AEKKKLQANMNAALNKQKEAEIEMLNKQKEMQELERQRLEQERVLGLENQNLRDKLEQLE
RDQKNKELEKQLKLMVVPTKSVQNGQGVDAVDSGKADPLSFDGIREKVPASRLHEVGLLT
KKEFDKLKKGKTNVQDLGQSEKLKGILKGKNSIAGLLSPTHQKMSIYQASKEKKITPGTA
MILLEAQAATGYLIDPIQNKKLSVNEAVKESLIGPELHNKMLLAERAVIGYKDPYTGSKI
SAFEAMKKGLIEHDHAVRILEAQLATGGIIDPINSHRVPKELAFKQGHFDAEMSKSLENA
SDDTKGYFDPSTQEPLTYSQLMERCATDPDTGLLLLPITDKAAQCSSIFTEEETKDVFSK
TQVSVPFGKFQGRTVTIWEIINSEYFTEDQKRDLLRQYKTGKITIEKIIKIVITVAEEKE
KKNEIAFDGLRAPVPATELLESKIIDKDLYNKLQTGKKTIEEVSDTKDVKTALKGTNCIA
GVMIESTQETMSFYQAMKKDIMWPAPALHMLEAQAGSGYVIDPVKNQKHTVDEAVKAGIV
GPELHEKLLSAERAVTGYKDPYSGQTVSLFEAMKKDLIPTDQGMRLLDAQLTTGGIIDPV
KSHHIPQEVACKRGFFDNETRQLLNKPTEENQHFFDPNTQEQVTYSQLFARCIVDKKTGL
PLLPLSDQAISSKEIQKYTESQTKEALTQATVEMNSGPYKGRKITIWEIINSEYLTEEQR
RDLIKQYRSGKITIEKIIRIVITVVDEKEAKKEQQVSFKGLRAPVTAESLFNSKIIDKET
FGLIQEGKTTPKEVSANPNVNKFLQGSDSIAGLYLETSQEKISIYQAMKRNLLRHETGLS
LLEAQAATGFITDPVKNQCLSVDEAVKSGLVGPELHEKLLSAEKAVTGYKDPFTGNKISL
FEAMEKDLVLKEHAMPFLEAQMVTGGIIEPVKSHRVPIDIACKMNIFSKDIVKTLSEQSD
DNKVFSDPETDGHVTYKQLREKCTKDPETGMYLLPLSKPQSPTPVIVEKTYLYTEEQTQS
DLANTKMEIPIEGLTGESMNLWDVMNSNLLPEKERQRLMDEYRSGNITKERMIIIIIEIM
EQREIIMNDGPMSCTTIRRRITIEELYNARIINVELYNLLKSGKREVRDVMEMTDVKQYL
YGTGCVAGVTTDTSAKLSIYQAMKRGFLKPEVALSLLEAQAATGFIVDPLKNETLTVDEA
VRKGVVGPEIHDKLLSAERAVTGYKDPYSGKIISLFQAMKKDLVLEDYALKMLEAQNSTG
GIIDPEFQFHLPADIALKRGYINKETNERLSDDVKGFVDPVTEEKLSYSQLLKRCKLVGG
LRLLSLGDKRLTFKGLRKQITLEELLRSQIIDEETATQLKEGLITVEEVSARLSRYLEGT
SCIAGVHVENTMDRLSIYQAMKKNMIRPGTAFELLEAQAATGYVIDPIKNLKLTVHESVR
MGIVGPEFKDKLLSAERAVTGYRDPYSGKTISLFQAMKKGLILKDHGIRLLEAQIATGGI
IDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLGLMERCITDP
DTGLVLLLLKEKKREGKSSSKSSVRKRRVVIVDPESGREMTVYEAYKKGLIDHQTYLELS
EQECEWEEITMTSSDGTVKSIITDRRSGRQYDVDDALARGLIDKNSLDTYRSGNLSISEF
ADMLSGTMGGFRSRTSSFSSTTGSTSSSFAMSPLPTIKAPAVIWNDPSEETGPIAGILDT
DTLEKVSVTEAMHRNLVDNITGQRLLEAQACTGGIIDPTTGERLPVPEATEKGLVDKIMV
DRLSLAQKAYNGFEDPRTKERMSASQALKKGWLYYEAGQRFLEIQYLTGGLIEPDVEGRV
SLDDSIKKGSIDARTAQKLRDVSAYSKYITCPKTKLKISFKDAMDRCMVEEGTGIKLLEA
ASQSSKGLYSPYNVSGATSAAGSRTGSRTGSRTGSRRGSIDAGSGFSMNFSSSSFSNSSS
GYGRRF
Download sequence
Identical sequences ENSGMOP00000007001 ENSGMOP00000007001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]