SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007018 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007018
Domain Number 1 Region: 209-310
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000249
Family Spectrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007018   Gene: ENSGMOG00000006609   Transcript: ENSGMOT00000007220
Sequence length 310
Comment pep:novel genescaffold:gadMor1:GeneScaffold_293:1701567:1703429:1 gene:ENSGMOG00000006609 transcript:ENSGMOT00000007220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNLISRPSCLGQRSKHVRSDEDFLKECYQRKREREMDEEERERGGKREEAVRTPVSDKP
LRRSPASTLTSTSTLDNGWHSTPSRTGTLTRRTMPPDLGRSPLAYPDKGSAERRASFQRR
DSREGSPWSWKTLASREVTEVTEVTETIVTEIVEVTEYPSGEKGGAPIVTRTVRVLNGVA
EELAECSILLFTLYCIQGTRSALTLRDESTDTETFLPNLESLLTWVCEIEELTANQKPPS
SEVKVVKAQLQEQKLLLRLLADRRKSMEFTISEGPALVEAHPGDEWVEAKVKLSTLKQKW
EALILGAEQR
Download sequence
Identical sequences ENSGMOP00000007018 ENSGMOP00000007018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]