SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007025 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007025
Domain Number 1 Region: 842-970,1003-1176
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.28e-78
Family Protein kinases, catalytic subunit 0.00000000214
Further Details:      
 
Domain Number 2 Region: 699-784
Classification Level Classification E-value
Superfamily Immunoglobulin 5.46e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 362-436
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000147
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 241-337
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000417
Family I set domains 0.033
Further Details:      
 
Domain Number 5 Region: 587-674
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000957
Family V set domains (antibody variable domain-like) 0.027
Further Details:      
 
Domain Number 6 Region: 426-471,524-570
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000039
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007025   Gene: ENSGMOG00000006586   Transcript: ENSGMOT00000007227
Sequence length 1352
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3590:2922974:2963412:-1 gene:ENSGMOG00000006586 transcript:ENSGMOT00000007227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLAPPGLVIGFSMTPPALDSGSEDLVIPVHTTLTITCXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSDPWASDTGTYRCHYRDVLPPIDGA
TAASTYVFVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDP
MSMETEGLTWNSKQGWTVPMHVFDSVPMGLWCQTTVGGQQHQSTSYLLHITGSEVYNVKL
FPEQPVELLVGEALTLNCTVSVEFNTAVDFNWTYPGTNSLANIWPKREPQMHATEVVSVF
SIPSANVSDTGLYRCTVTTPLSTHTLDTVVIVHKEPFISMDYRNGPVVEVTAKQKSFKLT
GVSGYPTPETLWYKEGRPVPEFKNKRMKVHPSHALEIKDVMEGDGGRYTLVLRNTAAGLQ
ESLNITLVVNVPPQIHEKKVAEPSSPYPSGSSQTLTCTAYGQPAPNISWHWRPWGAPGPC
LLNNTKGRTPSRVRKGRSDQISACQNWQDITPESAVNEMELSETSMELVDRKEKIVSRLH
IQNASVSVMYKCLAENKVGRDERLVYFYVTTVPEGFRVEAVPSEQPVEQESLSLRCTADN
YTYEHPRWYRLEPRLLQEQRGRPQEDRECRSVHLYAGELGGRLSFRGAHNSWELEVTIAA
VALADEGNYVCEAQSRRSGEKQCLLKYISVKPLEPRYRHGPSNQTVNVTGSLRMECDVEG
RPPPQLSWFKDHQPLHQMSGIQLQDSNRTLSIQRVREEDAGLYTCTACNQRGCVHSSASV
QVIGSSDRASVEIVILVGTGVIAVFFWVLLVLIFCNVKRVNPADIKTGYLSIIMDPGEVP
LDEQCEYLPYDSSEWEISRDRLRLGKVLGHGAFGKVIEASIYGGSKNSSPDTVAVKMLKE
GATASEHKALMSELKILIHIGNHLNVVNLLGACTKPNGPLMVVVEYCKYGNLSNYLRAKR
EFFLPYRDRSPKTQSQVRRMIEAGRVEQRASPPPLPIPPTPPPPPPPPLEDLWKSPLTIE
DLICYSFQVARGMEFLASRKCIHRDLAARNILLSEDNIVKICDFGLARDIYKDPDYVRKG
NARLPLKWMAPESIFDKLYTSQSDVWSFGVLLWEIFSLGASPYPGVQIDEDFCKRLKDGT
RMRAPETASPEIYGIMLACWQGEPRERPTFPALMEILGDLLQDNSLPXXKDYVPLNQSQS
SEDDGFSQTSSHPASEEELRMPCSTLPARYYNCVPFTGCVFVAPSKMCQPRVKTFEELPL
ELHQQKSQQDSQTDSGMVLASEEFEIIEHQSRSTECLTGSLASTGSRHRPGFHSQLSGQT
FYNNEYGQLSEHGGVCDFFSSADPTCPATSNL
Download sequence
Identical sequences ENSGMOP00000007025 ENSGMOP00000007025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]