SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007031 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007031
Domain Number 1 Region: 89-180
Classification Level Classification E-value
Superfamily EF-hand 1.45e-16
Family Polcalcin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007031   Gene: ENSGMOG00000006616   Transcript: ENSGMOT00000007233
Sequence length 212
Comment pep:novel genescaffold:gadMor1:GeneScaffold_293:1714959:1716299:1 gene:ENSGMOG00000006616 transcript:ENSGMOT00000007233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELNRKFPEVENATKSCKRKSIPKQQISPSKRLFIKKRSALKLQPAPALPLEHLDPQTP
QLTQLVSSWQRLWLLALARQTRLDQHQLTLIQMEEFANFDFNVWRRRYMQWISHLKSRIL
DVFRTIDRDQDGRISLKEFMDNVLASKFPTNALEMNAVASIFDTNSDGYIDYYEFVSALH
PSRDPYRRPLDPDHINEEVSRQVSQCNCPRKF
Download sequence
Identical sequences ENSGMOP00000007031 ENSGMOP00000007031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]