SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007122 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007122
Domain Number 1 Region: 57-309
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 3.66e-18
Family Glycerol-3-phosphate (1)-acyltransferase 0.036
Further Details:      
 
Domain Number 2 Region: 368-491
Classification Level Classification E-value
Superfamily EF-hand 1.11e-17
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007122   Gene: ENSGMOG00000006686   Transcript: ENSGMOT00000007326
Sequence length 534
Comment pep:novel genescaffold:gadMor1:GeneScaffold_891:431058:454519:1 gene:ENSGMOG00000006686 transcript:ENSGMOT00000007326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRYELGKMRLPTSRQQCAMMEGDGGQKTEHAPPLRNPFVHLLRFTPLEKAKIALMTVTIF
PIRLIIVAFMMLLAWPFAFLASMGRSEAVVEPQCLWRRVVDLLLKVIMRLMWFAGGFHWV
KVKGRKALPAEAPILTLAPHSSYFDAIPVTMTMASIVMKAESKDIPLWGTLIKFIRPVFV
SRSDPDSRRKTVEEIKRRACSGGEWPQIMIFPEGTCTNRSCLITFKPGAFIPAVPVQPVV
IRYPNRMDTITWTWQGPGAFEILWLTLCQLHNEFEIEYLPIYTPSEEEKGNPALFANNVR
RIMAKALRVPTTDYSFDDCQLAMAEGQLRLPVDTCLLEFAKLVRRLGLKTKSTEQVLQDY
GRRARKLEGQKLSLEDFALYLDMPVSDMLRETFALFSEHEDNTMDIREYVIALSVACRPA
KTLETLKLXXXMFEAEQDGAITEAELAVILKTALGVAELSVSRLFVALDPTDTGKITFDT
FRRFMDQQPDFAEDYLYADNEVLHSRLATAPLKMANGICPKFSPKDHSSVKKHN
Download sequence
Identical sequences ENSGMOP00000007122 ENSGMOP00000007122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]