SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007183 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007183
Domain Number 1 Region: 144-295
Classification Level Classification E-value
Superfamily EF-hand 6.16e-23
Family Calmodulin-like 0.023
Further Details:      
 
Domain Number 2 Region: 53-166
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000216
Family Calbindin D9K 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007183   Gene: ENSGMOG00000006747   Transcript: ENSGMOT00000007387
Sequence length 301
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2011:54809:56525:-1 gene:ENSGMOG00000006747 transcript:ENSGMOT00000007387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLSALIALLAINFAFGRLEDNHYIDQQHNPGHDVNVLIGNQNTKETGQMDPSQQREKII
EIVKKIDINSDKMLSTEELALWIQQVYRKYALEDVEERFPKFDPNADGVVSWEEYNNKLI
TLDDAAVLNDPEQESIRYLSLKEKRRFDFADVDDTAGLNLPEFLAFTHPSEVDHMADFTI
EDVLTEYDRDGDGFISLTEFIGDVRGNEDTPSQWEVEETVRFKELYDQDKDGKLNPQEQL
RWVAPNSYGSAREEALHLVKEMDHDGDGKISEAEVLKNQESFMNSEVTDYGRQLITSHDE
L
Download sequence
Identical sequences ENSGMOP00000007183 ENSGMOP00000007183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]