SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007213 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007213
Domain Number 1 Region: 641-679
Classification Level Classification E-value
Superfamily SAP domain 0.00000022
Family SAP domain 0.0027
Further Details:      
 
Domain Number 2 Region: 893-939
Classification Level Classification E-value
Superfamily EF-hand 0.00000449
Family Calmodulin-like 0.035
Further Details:      
 
Domain Number 3 Region: 151-210
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000685
Family Cold shock DNA-binding domain-like 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000007213
Domain Number - Region: 1009-1081
Classification Level Classification E-value
Superfamily Tropomyosin 0.00301
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007213   Gene: ENSGMOG00000006757   Transcript: ENSGMOT00000007417
Sequence length 1100
Comment pep:novel genescaffold:gadMor1:GeneScaffold_25:233980:252745:1 gene:ENSGMOG00000006757 transcript:ENSGMOT00000007417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFGGQKNPPWATQFATGAAFCYSLALGVQQPSLLGASPSMYAPQSALAAASLGNQSAA
NYQLSQQTAALQQQAAAAAAAAALQQQQQPPPQQQMYNVPHQLPQPQQALLSQPSGALPT
SLGMSNQQTAQITVSYPTPRSSHQPQAQPQKQRVFTGVVNKLHDTFGFVDEDVFFQLSAV
KGKTPQVGDRVLVEAVYNPNMPFKWNAQRIQTLPQLSNQSNQPPPNMMKQGPPMMQSLPP
PNSFNVPNQGPPPSLLQPQMSAASLAPLLQNPPQPLLPQPPPKGGLLQPPVRMMPQPQPV
RRIEPPPRFPNRIDRGPELILRPKEERSRDRERERRRSRERSPTRKRSRERSPRRERSPR
RPRRVVPRYTVQFSKFSLDGSNCDMMELRRRYQSLYIPSDFFGAVFTWVDAFPLQRPFQF
GNYCNFHIMHKEVDPLVKNTAVLDPPDANHTYSAKVMLLANPGLEELYHKSCALAEDPQE
LRDAFQHPARLIKFLVGMREDEAMAIGGHWSPSLDGAEPETDPSVLIKTAIRCCKALTGI
DLSLCTQWYRFAEIRYHRPEESHKGRTVPAHVETVVLFLPDVWHCLPTRSEWEGHSRRLR
EQLAEKLTFTLPHNNKTRTEEKEDEEDAKEVTIPTHWDKLDPKSMKVNDLRKELDCRSLS
SKGLKSQLIARLTKQLKVEEQVEEAKEPEKPEVKVPEEEESREEDKEEEERRKLEELERQ
RRERRYVLPEEPTILVYPNWAAKNGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFN
EMLQRDFGYRIYKALASLPAKDEKKDKDKEKKAKKEVEKRDIKKEKEEESEEPTRRRRRS
EEKVPNLKKEESREEEEGEDEGSTANAEEYDPMEAEDADEEEDNEKKLMLTYNKELLMAF
VYFDQSHCGYLMERDLEEIMYTLGLHLSRAQVKKLLNKPVVKESCYYRKLTDLGKDEAPP
SFIDTQVEHLLGNRALPVPDGSAQAESSESGGLIVFNGAMVDVGSMMTKLDKSEKAREEI
EQKLIMLDAKMDEDTKAMGSMEQANKALSKELEEVKGTLGLTQETLKTTEELKTTYHRQI
NTCAGSLTSAVKELLATLGK
Download sequence
Identical sequences ENSGMOP00000007213 ENSGMOP00000007213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]