SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007227 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007227
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 3.25e-55
Family Calmodulin-like 0.0000000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007227   Gene: ENSGMOG00000006800   Transcript: ENSGMOT00000007431
Sequence length 193
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1770:295322:297762:-1 gene:ENSGMOG00000006800 transcript:ENSGMOT00000007431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKQNSKLRPEVLNDLRENTEFSDHELQEWYRGFLKDCPTGHLTVDEFKKIYANFFPYGD
ASKFAEHVFRTFDTNGDATIDFREFIIALSVTSRGGLEQKLRWAFSMYDLDGNGYISRAE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTDNDGRLSLEEFIKGAKSDPSIV
RLLQSDQGTSRQF
Download sequence
Identical sequences ENSGMOP00000007227 ENSGMOP00000007227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]