SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007283 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007283
Domain Number 1 Region: 2-409
Classification Level Classification E-value
Superfamily Sema domain 3.83e-124
Family Sema domain 0.00000000464
Further Details:      
 
Domain Number 2 Region: 411-443
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000746
Family Plexin repeat 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007283   Gene: ENSGMOG00000006845   Transcript: ENSGMOT00000007490
Sequence length 454
Comment pep:novel genescaffold:gadMor1:GeneScaffold_503:411:27347:1 gene:ENSGMOG00000006845 transcript:ENSGMOT00000007490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYWKVTREKQKECAYKGKQSEVECRNYIQTLHPVNQTTMYVCGTNAFSPVCDYMTQLVLH
GQQEEGGKCPFDPFQRYSSLMVGSDLYSATFINFLGSEPVVLRSSQTAVRTEFKSSWLNE
PTFVYMDHIPESVDSADGDDDKVYLFFSEKAMEYDFYSKLTVSRVARVCKEDMGGQRTLQ
RKWTSFVKARLDCSLPEPSLPPIVQDVFLLKDHNWRRSVFYAVFTPQSGSSRLSAVCAFS
VTAVREVFNEGKFKTPVAVETSHVKWVMHSGELPVPRPGACINNAARRLGMGNSLDLPDK
TLQFIRDRPLMDEAVRPLTGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGFIQ
KAVNYEGEMFVIEETQVYEDPQPITTLRLSSTKGHVYAGSTSGVVQMPVSNCGRQRSCSD
CVLARDPYCAWDLPTARCASLGTGAAVQSLVEGD
Download sequence
Identical sequences ENSGMOP00000007283 ENSGMOP00000007283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]