SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007284 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007284
Domain Number 1 Region: 330-451,498-631
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 6.28e-63
Family Mammalian PLC 0.000094
Further Details:      
 
Domain Number 2 Region: 644-769
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.21e-30
Family PLC-like (P variant) 0.00048
Further Details:      
 
Domain Number 3 Region: 31-143
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-22
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 
Domain Number 4 Region: 157-276
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000262
Family EF-hand modules in multidomain proteins 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007284   Gene: ENSGMOG00000006835   Transcript: ENSGMOT00000007491
Sequence length 980
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2237:144133:164419:1 gene:ENSGMOG00000006835 transcript:ENSGMOT00000007491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPSVQKMGAGRKKTVSFSSMPSEKKVSSSSDCLAFMQGGCELKKVRPNSRVYCRFFTLDP
DLSCLRWEPSKKDGDRARLDISCIREVRTGKSTETFLHNGPLSEHLAEEAAFSIIHGDEY
QSLDLVALSADVANIWVTGLRFLVVGGYVVEGSPGSRMRSEWLAAEFAQVDADGNGVVTE
NVAVAAICKLCPGIKEAKVRQRFKEIQCAKEKLTSHVTREEFQEAFCELCTRPDVYFLLV
QLSKDRECLDVQDLRLFLESEQGLSLATAEGCLQLLRXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXASYRSYLLDDQVHGRADLGGLTKALQAGCRC
LELGVTDGPEGEPLLGVDYGPEAPVTIRSALEVVNKYAFLTSPYPLLLYLCQRCSPAQQR
VLAQHLKKAFGSRLYGPTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFYAQSEPPYWTLCSLGEG
EAGRLTSETPEELVVFTKRTLSRVRPSSVRLDSSNPNPQGYWKGGVQLVALNQQTPGAML
DLHRGRFSVNGGCGYVLRPGVMREEVSYFSAHTQGCVPGVPPQTLRIKVISAHNLPKPQG
AGAKGEVIDPYVVLELHGVPADCAEQRTRTAAQNQDDPLFDETFEFQVNMPELALLRFVV
LDDDYIGDDFIGQYSVAFECLQPGYRSVPLLGLAGDPLPHASLFVHVAVTNRAAGKAQRR
GLSVRRVGRRGREYVSLRHTGIKVVDEGFKPASGPLREATDLREDAQSATVSFKEQCGLP
PVAKLKQCIESLATRLQSAEGSVGAVMVLKEGYPCLEPLHTLPEPTRKVLTAYDAMIAAQ
KQLIENADVVQERIAQVQREGHCDLLRGAKVDSLDVLRQLALASEACGLTCSTSSSSAEL
HHTSHQTAGRRGSSHGNGRI
Download sequence
Identical sequences ENSGMOP00000007284 ENSGMOP00000007284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]