SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007287 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007287
Domain Number 1 Region: 76-152
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000657
Family Calmodulin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007287   Gene: ENSGMOG00000006856   Transcript: ENSGMOT00000007494
Sequence length 155
Comment pep:novel genescaffold:gadMor1:GeneScaffold_678:52905:54602:-1 gene:ENSGMOG00000006856 transcript:ENSGMOT00000007494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRRTRSSRGMELSCVFIILSSCCLLCVRSHGEINRHRLRTTHMSGHGRLDRNMIQDKNH
IMEHLEGVIDKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELATAITHVHKEERGENTQP
MKEEDLINLIDDVLRDDDKNNDGYIDYIEFAKSLE
Download sequence
Identical sequences ENSGMOP00000007287 ENSGMOP00000007287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]