SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007316 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007316
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily EF-hand 5.81e-57
Family Calmodulin-like 0.00000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007316   Gene: ENSGMOG00000006889   Transcript: ENSGMOT00000007524
Sequence length 151
Comment pep:novel genescaffold:gadMor1:GeneScaffold_678:134418:136987:-1 gene:ENSGMOG00000006889 transcript:ENSGMOT00000007524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQLTEEQIAETEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA
DGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLT
DEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Download sequence
Identical sequences G3NDL7
ENSGMOP00000007316 ENSGMOP00000007316 69293.ENSGACP00000003417 ENSGACP00000003417 ENSGACP00000003417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]