SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007322 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007322
Domain Number 1 Region: 2-159
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-39
Family DBL homology domain (DH-domain) 0.0015
Further Details:      
 
Domain Number 2 Region: 149-273
Classification Level Classification E-value
Superfamily PH domain-like 7.71e-23
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 3 Region: 252-363
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.1e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007322   Gene: ENSGMOG00000006882   Transcript: ENSGMOT00000007530
Sequence length 369
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4129:166867:181040:-1 gene:ENSGMOG00000006882 transcript:ENSGMOT00000007530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVRNLFSNIPSIHSFHSQFLLPDLEERMVHWWDRPALGDVLLRHAPFLRMYSEYVGNFEV
AMGLLKAWRERSAAFRNVLLEIQSQEVCGRLSLEHHMLEPVQRVPRYEMLLTAYLTTLPR
DDPDLPRALEAIAMAAGHSNSAIHRAESLKKLLDIFEMVSEEEILRPSTEFLREGRLLKL
AARNKSAMERYLFFNDFLLCCTPRLVLVGQRYGARTRIGVEGMTVQRTTNHEHPHSFQVS
GKEKTLELEASSEKERDEWIKVIQKAIDVSHAKIETLKLASKVSSQTEPDVSLEEELGRR
APRWTRDNEVMECMKCREAFNAFTRRRHHCRACGCVVCGKCSDHKVALEYDEGRLNKVCD
TCHGVLSGQ
Download sequence
Identical sequences ENSGMOP00000007322 ENSGMOP00000007322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]