SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007365 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007365
Domain Number 1 Region: 283-415
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000797
Family Calmodulin-like 0.052
Further Details:      
 
Domain Number 2 Region: 169-283
Classification Level Classification E-value
Superfamily EF-hand 0.0000000466
Family Calmodulin-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007365   Gene: ENSGMOG00000006923   Transcript: ENSGMOT00000007574
Sequence length 445
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3820:15255:42345:1 gene:ENSGMOG00000006923 transcript:ENSGMOT00000007574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAFRRALAVLASRLHPRSPSSSELVGWPTSRTRRRAAGMCLATGGAIMAAFYLYNDKSK
YKRSANRLSRLLPSVPAVAAKEKAHPYDFDEGEVHMSSHEHRFRLFSSVEFEGQLYMTPH
NFIESVTMSEPRXXXXXXXXXXXELEKTLSDTPPVWRGTSKLFRNLRERGIIAYTEYLFL
LCILTKPHAGFKIAFNMFDADGNEMVDKREFLVVLKKDSEEFVARSYWDILRRCASQALF
SDLAERTDENIMTDTTLLVHFFGKKGKAELTFDDFYRFMDNIQTEMLEIEFLNYSKGMTT
ISEEDFARILLRFTNVENINAYLENIHHCIPDDKGITFDEFRSFFQFLNNLEDFAIAMQM
YNFAARSIGQDEFARAVFVATGLKLTRHLVNTIFKIFDVDHDDQLSYKEFIGIMKDRLHR
GARGYKSEEHFTSFRSCLRKELASR
Download sequence
Identical sequences ENSGMOP00000007365 ENSGMOP00000007365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]