SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007403 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007403
Domain Number 1 Region: 690-788
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-22
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 2 Region: 1207-1337
Classification Level Classification E-value
Superfamily Second domain of FERM 7.59e-21
Family Second domain of FERM 0.0039
Further Details:      
 
Domain Number 3 Region: 802-918
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-17
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000007403
Domain Number - Region: 1109-1188
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0878
Family Ubiquitin-related 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007403   Gene: ENSGMOG00000006939   Transcript: ENSGMOT00000007615
Sequence length 1485
Comment pep:novel genescaffold:gadMor1:GeneScaffold_678:184111:214291:-1 gene:ENSGMOG00000006939 transcript:ENSGMOT00000007615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGEEAMSQEDWKEKCLVLEALLMKFRVQIIKIRELTGDKIQQLEMQVIDAEKRAFNAQ
QQMQWVGEKLQAPDGQAGGSEVRLLGRCQELQALLQEKGEAVVLLEQQLEEQKQIRLQDS
KTVEEKAAKIKEWVMLKLSDFEMENAALRESNRQQEAQIQELQKQVLALEQKRGSGGGAP
PGEAQRLSSLTFGCFQVRGKSPQVLTGPEPSQRTVSAQERPSGGEAXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALSLLRPL
RPQETDLDGDQEPRREVVMETGPQEVPGSGSAPQSPGDTLEPYSAAPGSKPPTPPLHRFP
SWESRIYAVAKSGIRLSETSCTDPAGKDPSLQSSYPAFVFYTSLIYNNMTTPVYTTLKGX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSMSSVTSES
DYAIPPDAYTTDTDCSEPEQKLPKTCSSASDEPMEKSGYLLKMVKTWKKTWKRRWFVLKD
GELLYYKSPSDVIRRPQGQIEVNATSSXXXXXXXXXXXVVTGRRVCYLKADSPNLLEEWL
RVLQSVLRLKAASPLFTQPDVRPSMKGLLLKVKHGYSKRVWCALIGKTLYYFRSQEDKFP
LGQIKLWESQVDEVDASRDSDENLKACGQGLQAAPFTIAVHPQEQGPTYLLIESRHEKES
WLYHLSVAAGALLGKVGTEFEQLAGKLFQLDGDPNSPTWRHPVLCFSKDALVSPLTTLPS
QALQTEAVKLFKTCQLFINVAIDAPAIDYHVSLAQSALQVCLAHPELQNEFFCQLIKQTR
KREPHGQPGPLQGWQFLALCVGLFLPQHPFLWLLQVHLKRHADARTEVGKYAIYCQRSLE
RTQQKGERQARPSRMEILSILLRNPYHHSLPFSVPVHFLNSAYQVVSCDASTTVEEFQCR
LNQDSGVRKTAQSGFSLYTDDPTGRDLEHCLQGGIKVCDIISKWEQASKEQHTGKSENTR
TVRLTYKNRLYFSPQVRGESERERLLLAYQTNEAILAGHFPVNKELSLEMAALLAQVEFG
DFERPFSAAGSAQTKSVQTLKQVLERFYPKHYRKTTSEEQLRQLLQRLSVRWASLRGRSS
PECVRIYLTVARKWPFFGAKLFEAESVTASPEQGARVWLAVHEDGISVLEHNSMKPLVSL
PYKNLGTFGGCNQDLMLVVGQSAGQNTSKDKPTERHLFAMPTSKIREMTLLISSYVNSAH
QLKAAAHHLSAPALLVAQPVTLKSKELRSKSPQAKGRTSKAPTLL
Download sequence
Identical sequences ENSGMOP00000007403 ENSGMOP00000007403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]