SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007525 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007525
Domain Number 1 Region: 42-206
Classification Level Classification E-value
Superfamily EF-hand 9.06e-41
Family Penta-EF-hand proteins 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007525   Gene: ENSGMOG00000007066   Transcript: ENSGMOT00000007740
Sequence length 213
Comment pep:novel genescaffold:gadMor1:GeneScaffold_809:37471:43212:1 gene:ENSGMOG00000007066 transcript:ENSGMOT00000007740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFHYGQGHPQVGTPGGPYGGYGAQPQGGSYGHQGPAGNVPPGVSPEAFQWFQTVDTDHS
GSITLKELKQALVNSNWSAFSDETCLMMINMFDRTRTGRIDVFGFSSLWGFMQQWRALFQ
QYDRDRSGTINGTELHQALGQMGYNLSPQFTETLVGRYAVRGGRPGVQLDRFIQVCTQLQ
SMTQAFRERDQAMTGNVRLSYEDFLSGTVQRLM
Download sequence
Identical sequences ENSGMOP00000007525 ENSGMOP00000007525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]