SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007542 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000007542
Domain Number - Region: 720-809
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0892
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007542   Gene: ENSGMOG00000007076   Transcript: ENSGMOT00000007758
Sequence length 896
Comment pep:novel genescaffold:gadMor1:GeneScaffold_809:154411:181664:1 gene:ENSGMOG00000007076 transcript:ENSGMOT00000007758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGTFPRSHPSQQHPPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXQDLTMRKPKERGGGGPGPGECLACNAMAGNDGPSRGHKDHSL
KRSTWSAMTVSQAREVYPSSRGGGYDKALVPLEKQLKERNFHYLQVPSDEWGGGRRGGGS
GGEIPCRRMRSGSYIKAMGDDDSADSDAPSPKTSPKSSLIAQRDAFRRSISMDQSWTTPK
NHARSRSYTRSLTSAQLGDSLNRQFETVCETMFGEVESQAMEALDLPGVFRTRSHSYVRA
IQAGCSQDDDCLSVFSVSGPQGSMKAGAGEIFPYRKGAPPPLPPRMSKSSLSVRAQSSTE
STQDAYFAKHSSSADSLLEGPPRPARERDGRAGGSLGKSASLPQNSMVLSKTPGGQXXXX
XXXXXXXXVDSSETLSDSDLEGKALREVHSIGVQVEDDKRRARFKRSNSVTASVQADLDP
EGFPPGLGLAAPMQDKGLQFGCSFQRHSSEPESASQYAEFHRTVHTQGQWAYREGGYAPE
SCQTDARPHPLPSRAHSPLPLTSERAWAGTPSLEGPRSLPDSGRASPCMRDGEFFLRLLQ
TEVERIEGWCQGMEREAEENELPEEALELIRNAIGSAQMLMSQKVQQFFRLCQQSVDPSA
YPQPTSQDLASFWDLLQLNIEDVRVKFQDLQRIKDSGWLPAEKKDKKLPPPLPKKPAGGG
RTLPVREKSLDLGDRQRTEARRRLLQTKRTASFRQNSATESADSIEIYIPEAQTRL
Download sequence
Identical sequences ENSGMOP00000007542 ENSGMOP00000007542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]