SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007559 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007559
Domain Number 1 Region: 27-108
Classification Level Classification E-value
Superfamily EF-hand 2.49e-21
Family Calmodulin-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007559   Gene: ENSGMOG00000007104   Transcript: ENSGMOT00000007776
Sequence length 218
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4258:334366:354574:1 gene:ENSGMOG00000007104 transcript:ENSGMOT00000007776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFHHVRAGLLYPDNYLSSSLSEGSEAFQLTSISPEELAEIREAFRILDRDGNGFISKQE
LGMAMRSLGYMPSEVELAIIMQRLDMDAGDGQVDFEEFMTILGPKLLSSDNREGFLGTTI
DNIFWQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPK
KKNRQTCVRKSLICAFAMAFIISVMLIAANQMLRNGME
Download sequence
Identical sequences ENSGMOP00000007559 ENSGMOP00000007559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]