SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007614 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007614
Domain Number 1 Region: 301-375
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000483
Family Calmodulin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007614   Gene: ENSGMOG00000007130   Transcript: ENSGMOT00000007832
Sequence length 458
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2525:15589:23835:1 gene:ENSGMOG00000007130 transcript:ENSGMOT00000007832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYTDRVASRRRAGKLIPPGDRVKTCLQEIPRPPTPPDLKKFLKTTQPEPGFIRVLSGKAN
DPDIPPDLVHGIRTRASINADRVVNPPRQTRFQDKLLEHREAGYASRRTAPLGRSHAQSA
GLPKWYGDATTFGLKSVSTGTAGQTVNPPITAEQVDTEALIGHKDYILSHNAYFVGEPID
RKYDWSVHSRSSRFGVSTPHHSDGRRLAKLLRWPSDEQKSRCNAIFASEISVDFRARITY
GPTVGEIAETPNILPDHTFGVLVPADKFGSAAELIHCGDPGRFPRLQERQRGAVSAIQQT
LKKLNCRAFPNLMEAFSHYDKKGRGVIDREDLGAVCLEYGVRAGEAVLDDLMSTCDADRD
GVLDFLEFANFLNWKQKMPISHAEQRVLTEYKKINCVEDHISDSSSLCITIVCALINPED
LEPLEPGSSLKVPRTISLQPRTAPDHFVTSSSKIRATV
Download sequence
Identical sequences ENSGMOP00000007614 ENSGMOP00000007614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]