SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007618 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007618
Domain Number 1 Region: 619-686,865-1205
Classification Level Classification E-value
Superfamily Ras GEF 1.31e-95
Family Ras GEF 0.0000536
Further Details:      
 
Domain Number 2 Region: 21-127
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-19
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 230-316
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000000353
Family DBL homology domain (DH-domain) 0.0045
Further Details:      
 
Domain Number 4 Region: 432-587
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000176
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Domain Number 5 Region: 384-442
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000458
Family DBL homology domain (DH-domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007618   Gene: ENSGMOG00000007143   Transcript: ENSGMOT00000007837
Sequence length 1208
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1288:61050:110604:1 gene:ENSGMOG00000007143 transcript:ENSGMOT00000007837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALFLSLLARKEGTKRGYLSKKTAENSRWHDKFFALYQNVLFYFENEQSA
RPSGIYLLEGCTCERAPAPKMSTAAKEPLDKQHYFLIVFGHDGQKPLELRMEEESECDEW
VEAIQQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIA
LNKTKERMRPYHVNQEEEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKR
NQIVFNMVEAETEYVHQLYILVNFFLRPLRMAASSKKPSINHDDVSSIFLNSETIMFLHE
IFHQGLKARIANWPTLVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSS
RVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLG
SLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKQGGVLSLIDCTLIEETDASDEESKSG
STVFGQLDFKLVVEPPDAQAFTVVLLSPSRQEKGAWTSDISQCIDNIRCNGLMTSVFEEN
SKVTVPHMIKSDVRLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLN
TFLHTYRIFTTAAVVMDKLADIYKKPFTSIPIRXXXXXXXXXXXXXVSARVGGLDLGSPL
TSTTPTRLPVASSSPTPPDPPDPPPPPTLPSAQRLQAPTGPASPEQGPASTTPEGEELPK
IDPFSGKLRRSIRRAVLESASLDKITPESPQSSDAGGEMSPCRSPSTPRHLRYRQPGAQS
AENSRCSVSPASAFAIATAAAGHGSPLYANAERTCDKDFIIRRAATNRVLNVLRHWVSKH
SQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTHTALSQDEQEDVQLRIEDILQM
AECPRAECFESLPAMELAEQITLLDHIVFRSIPYXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXMSNLVASQIMTHTDVGSRANSIEKWVAVADICRCLNNYNGVLEITSALNRSAIYRLK
KTWAKISKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPCVPYLGMYLTDLAFIEEGTP
NFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQVKVTQYLLDKTLIMDEDTLYDLSL
KIEPRLPA
Download sequence
Identical sequences ENSGMOP00000007618 ENSGMOP00000007618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]