SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007667 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007667
Domain Number 1 Region: 276-403
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-29
Family Second domain of FERM 0.0025
Further Details:      
 
Domain Number 2 Region: 407-509
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-22
Family Third domain of FERM 0.0065
Further Details:      
 
Domain Number 3 Region: 51-140
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000109
Family PDZ domain 0.0095
Further Details:      
 
Domain Number 4 Region: 187-259
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000379
Family Ras-binding domain, RBD 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007667   Gene: ENSGMOG00000007185   Transcript: ENSGMOT00000007888
Sequence length 1191
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3177:55:44189:1 gene:ENSGMOG00000007185 transcript:ENSGMOT00000007888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKNKTSGWPPPGPGPWGGLQGPPYSWDMNTPRDPRDYNIXXXXXXXXLEEVRPDGTPPAP
RLVEMRRDPVLGFGFVAGSEKPVVVRSVPPGGPSEGKLIAGDEIIMINEEEVSSAPRERV
IDLVRSCKESIVLTVVQPYPSPKSAFISAAKKAKLKSNPVKVRFAEEVIINGQVPNSAKD
SSLLFMPNVLKVYLENGQTKSFRFDCSTSIKEVILTLQEKLSIKSIEHFSLMLEQRREGG
ACRLLLLHEQEMLVQVTRRPGADKMKCFFRISFVPRDPVELLRRDAVAFEYLYVQCCNDV
VLERFGAELKYDAALRLAALQMYIITMTTRQTQKVSLKYIEKEWGLPLFLPPAVMASMKE
KNIKKALTHILKTNHNLVPAGKKLTVLQAKVHYLRYLSELQLYGGREFKSILLQGEKQTE
VLLLVGPRYGISHVINARTNLVALLADFSHVNRIEILTEDDANVRLELHVLDVRPITLIM
ESSDAMNLACLTAGYYRLLVDSRRSIFNMAHCNSMQGDDSGRLGDPGGRRSPLPPPLPPS
TRLQPQDSPRSAKVSFIFGGGAPPRKLTPRGYDLLMESPDVPGHRPPYLHHNADFRRHRR
RHHGAVSHVYSNIGGEEGNEELRGLCYADTTDDAEDEDDASXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSRGLSAESSSDSGNETNSSEMTEISELAAAHRLHESHMRLLVATREGYQPLLEEKTE
FPVSPSAGETLQPKARSPSRGHLLQPPAVPPRRTPLLDTATSGQDSLHVGPQMELSAAST
LQRPSSVTPGGKHHKKSGDSGAKYNTFSTRDGHWGGMGGSIGLLGLDQEQGGGYQRRQTS
LMVENSVVDGLGVNSIPRGYRGIPLPPPSASNRLSDEGEFRPTDNGAPAVEQDEHLVVAS
LISPNKKPLSAASDHGSSEAPADHPPISRQQSVARLCEYHLAKRISSLQGEAHNSLQGSL
CSSLDAGGSVNGSVGGTPTDSPLGPSNHHQRHPLSSSSSSLLRAVNYEEGKSSASGGSQG
CPGQNKELHPHADPAMLRKMLPNIHPPAPGSEPPQRPASATPSCKHKETSG
Download sequence
Identical sequences ENSGMOP00000007667 ENSGMOP00000007667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]