SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007706 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007706
Domain Number 1 Region: 927-1064
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 4.97e-57
Family FAT domain of focal adhesion kinase 0.000000287
Further Details:      
 
Domain Number 2 Region: 149-269
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-37
Family Second domain of FERM 0.00000211
Further Details:      
 
Domain Number 3 Region: 81-146
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.99e-23
Family First domain of FERM 0.00015
Further Details:      
 
Domain Number 4 Region: 472-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000615
Family Protein kinases, catalytic subunit 0.0000783
Further Details:      
 
Domain Number 5 Region: 270-304
Classification Level Classification E-value
Superfamily PH domain-like 0.000000762
Family Third domain of FERM 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007706   Gene: ENSGMOG00000007215   Transcript: ENSGMOT00000007927
Sequence length 1071
Comment pep:novel genescaffold:gadMor1:GeneScaffold_314:369:77364:1 gene:ENSGMOG00000007215 transcript:ENSGMOT00000007927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSYLETGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGVIQKIAEIHKLRCVSSLGLRLAHLRSDAMHWLHPDLGV
SHVREKYEKQHPQEEWRYELRMRYLPKGYLSHFSEDKPSLNYLYHQVKSDFMLQLADHVD
QDVALKLGCLEIRRFFREMPGNALDKKSNYELLEKDVGLRRFFPKSVLESLKAKTLRKQI
QQTFKQFANLNDEQSIHMFFEILSPIYRFDKECFKCALGSSWVISVELAIGPEEGISYLT
DKGSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXGDRALPSIPKVSNHEKRMEKRMDGVRTRAVCVSETDDYA
EIIDEEDTYTMPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNPALSVAVKTCKN
STSDSVREKFLQEALTMRQFDHPHIVKLMGVITDNPVWIIMELCTLGEXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTILEEEKAQQKERNRMELRRQ
VTMSWDSGGAEEAPPKPSRPGYPSPRSSEGFYPGPQHQGHYQQMSGYPGPHTLPSVPSAL
YPPPAALLDTHHAHTHPRHHVHSHGPHLGPPGPGXXXXXXXXXPCLLREDQLLIQQQQME
DDRRWLEQEERLLKPDTRSSRGSLDREDSGLQPPTGNQHIYQPVGKQEHAAPPKKPPRPG
APGHLGSLACLSSGDSYNDGLKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSK
IQPAPPEEYVPMVKDVGLALRTLLATVEETYPQLPACTHREIEMAQKLLNSDLAELISKM
KLAQQYVMTSLQQDYKRQMLTAAHALAVDAKNLLDVIDQSRLKMMSQARPH
Download sequence
Identical sequences ENSGMOP00000007706 ENSGMOP00000007706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]