SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007765 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007765
Domain Number 1 Region: 1340-1389,1426-1599
Classification Level Classification E-value
Superfamily VPS9 domain 8.5e-31
Family VPS9 domain 0.0027
Further Details:      
 
Domain Number 2 Region: 501-659
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.4e-26
Family Regulator of chromosome condensation RCC1 0.024
Further Details:      
 
Domain Number 3 Region: 1012-1051,1133-1214
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.57e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 
Domain Number 4 Region: 902-982
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000075
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number 5 Region: 15-91
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00000000432
Family Regulator of chromosome condensation RCC1 0.023
Further Details:      
 
Domain Number 6 Region: 668-868
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000305
Family DBL homology domain (DH-domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007765   Gene: ENSGMOG00000007250   Transcript: ENSGMOT00000007987
Sequence length 1600
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3169:3303:40227:1 gene:ENSGMOG00000007250 transcript:ENSGMOT00000007987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GERGLAHLWRGYACSLAPERLFLSRPVVQASLGTRHGLLLLEGGQVYSFGVSPWKQPPSP
GPPPALEPSLSGRRVVSVATGSSHCGAVTEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXSMQARKSSSTGDIRAEEAEGRRRLSLPGLLSQATVSPRLLRKLGRPRGPAVA
LTQLGGCIPGSQELLPPLQTEVWSWGHGGRGQLGHGDHLARGLQPLCIKSLNNKEVVRVA
AGDHHSVALTAGSQVFSWGSNSSGQLGHMESPTTVPRLAKFSEGIRVWDVAAGGSHSVFV
ADGDCVQPILYYSGRQGEEGEEKAGVYTQQPVLLPFCMNLGYTSSVCAGGGRCLSLSDRN
VMGFIAGLHEVASAERRFYCRLTAIKTWVLRPLLEAESLSPTLGAVLLGLLQTLVGGFSL
LYTLTGQHSASLTSALRRGRDLQTLLLLNHAHIFLDAYRQYCTYLGNFHVMGGFQALSKP
ALEVFGKTLDPLLRLSESPEEGPASDHLMALFALPLGHLGEYGRLLLKLATCYEVSSSEY
QRLHSACSQFEALTLHLKKRRKEAEYTHHFWKSFPGKMTDSLRRPGRRLVCESSNKALSL
LNASRFSVNWFILFSDALVHAQXXXHHVFPLATLWVEPISEENSEQYGLKVISPEETFTL
LACSPIEKAKWLRAINQTVDLALGGAGQKAEPPISRTASYTFHKDARLREATYEGRWLAG
RPHGRGVLKWPDGRIYTGSFKMGLEDGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEKY
MGVYQENQRQGSGVIVTQFGLYYEGTFKDNKMGGTGVLVAEDDTTYEGEFSEDWTLYGKG
VLTMPNGDYLEGSFSGEWGSGLKISGTYHKPFDPEETAPVVLGRLCVCAEDKWPSVFGEC
WAALGCMAPGQGPPSRAWEGIAVALTASRRHLQDSPEVMTRSMSRTLESLEVIPQHSGPI
TMERYTKIRLYLIKACDSPLHPLGRLLEVLVAVYRMTYVGVGANRRLLPQAVSEIKSYLD
RLFTIVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVVSSSSLLLPLLLPRLYPPL
FTLYALCGEQEEDLYWDCVLRLNRQPDLALLAFLGVLQKFWPSSIPVSLPLLGENQQILS
TTKDACFASAVETLQQISTTFTPSDKLKVIQLTFEEITQEVQSLLRADFLWSMDDLFPVF
LYVVLRARIRNLGSEVRLIEDLMDPCLQHGEHGIMFTTLK
Download sequence
Identical sequences ENSGMOP00000007765 ENSGMOP00000007765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]