SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007781 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007781
Domain Number 1 Region: 235-329
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000931
Family EF-hand modules in multidomain proteins 0.0000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007781   Gene: ENSGMOG00000007275   Transcript: ENSGMOT00000008003
Sequence length 464
Comment pep:novel genescaffold:gadMor1:GeneScaffold_984:158740:169813:1 gene:ENSGMOG00000007275 transcript:ENSGMOT00000008003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSALEVRMSLHSAWLLLLLSVCAGVWSVPIDRNPTDRGAEEEKPEENVCTTDTGLYYDRY
LREVIEVLETDPHFREKLQTANTEDIKNGRLSKELDLVGHHVRTRLDELKRQEMSRLRML
LKAKLDSTNTQSLQIDHASMLKQFEHLDPHNQNTFEAKDLELLISTATKDLENYDAERHE
EFKRYEMLKEHERREYLRGLDQEKREAEEKRMEELKDKHRHHPKVNVPGSVAQLREVWQE
TDGLDPHEFNPKTFFKLHDTNGDGLLDEQELEALFTKELEKVYNSKNEEDDMMEMEEERL
RMREHVMKNQKVDANKDRLVTMEEFLKSTQKREFNNPREWETLDDTKPVYTEAELQRFEA
ELKDKEEELKRRAETLRQEQDLLHERGKALDAQRKEYQQAVLEMSQRQNEQPAAADAKQP
PTGPHGELQFHQETNKLEDQVEQEADTPNNLPAEPPQNLPTHTY
Download sequence
Identical sequences ENSGMOP00000007781 ENSGMOP00000007781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]