SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007787 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007787
Domain Number 1 Region: 761-997
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-53
Family DBL homology domain (DH-domain) 0.000034
Further Details:      
 
Domain Number 2 Region: 994-1123
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-35
Family Pleckstrin-homology domain (PH domain) 0.00077
Further Details:      
 
Domain Number 3 Region: 643-697
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000366
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.017
Further Details:      
 
Domain Number 4 Region: 162-220
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000171
Family Ankyrin repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007787   Gene: ENSGMOG00000007258   Transcript: ENSGMOT00000008009
Sequence length 1378
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3225:25592:84085:1 gene:ENSGMOG00000007258 transcript:ENSGMOT00000008009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSRRKVPLYGQAKVFALLEGLDAMPGDVEVFIVLEGSTLLHFIKALSDVMLCFIVPGH
NLAEVVSVQAYLCSETTPLTCLGGATLEYVQDDAQDLAEHLVTHGHRLSSMDHKELSSVF
RLGQRSCRWAMDQLVALAMANLDIPQSWNVLGSPGGEVYRPRESPLHLAVRWGLVRLAEF
LLCQPGGLMAVLLPNEDGVTPLQLAQLAGNAELQDLLENPPNPLSTPPAGLTQVWAGPGR
LLRFCHDTGTLSLTVRQNGRRNSRQELHADILLLRERFRDDHFLKESAGRTIRALDFGLG
TTHVLPEWGRRGKEQTWRESSLFRSCAGHWIWRVGGEGEDCKKGQPIRKHPTPCSTSAAA
ARLSAMIHGKDRVYANAMLVDQVDDVDIKYRAGSPFAFSRSPPVAGRLFTPRRTETGDRA
PGTHHRTLSSPAASPRSPFASSPSLPSSPLASAFRLFEGHRRQTKPSAPLSPGLHHRGVS
LPETVRSLSPSVECGSGDEDILCHSYPVVCPRQQPRPREDKGSGETLQDYNQSLPGVSTQ
EGEAEVRLRSYSYSSPKAKPTRPLLNREAAISDLAEEQRAYSLTETNRDKRIEDEEDWDK
YIIPSKVESEKYKVSRTFSFLKSRMSSTRSKAKVKEKEVKEGKQKTGGANGHQFVAAWPP
ALLCVACDRPVPGKDLLQCFNCSLSVHKSCRDSVPPCGKSAKDTSSSLSSSPSSSSSLNT
AAREKRETAALSKSLSISTDCVDTPLFSELSAVLLGLEVESWSLAVSSEYCRLHDKRTIK
RQDVIYELMQTELHHIQTLTVMAEVFRRGMLEELQLDWACVARVFPCLDPLLLFHRNLFG
ALQERRHASSQAHQPRDYLIQNIGDLLLQQFSEENAEKMKQLYGDFCSHHTEAVNLFKEL
QQQNKKLQLFVKQQSNKSLVKRREVPEFILLVTQRITKYPVLLERILQYSQEGSQDYADL
SRALFQIRDIITAVDLSVSRFEKDQELQEVLGRLENKSLAKLKNDKVFRKQDLRSPQRGL
QHKGLVYWKTATGRLKDTLALLLTDVLVFLQEKDQRYVFAAVDQKPPVIPLQKLIVREVA
NEERGMFLISASSVGPEMYEVHTATREERNAWMRHIRHAVESCPEEEEEEERSTESEEAR
RASEARVQKIQKFQESLLSQDQQICSTLEEKLQLYAELTELTLGPGEPVTQRHLLVSPET
DADTPRQASTLLTAAVKEGEGGGGWGVVAESVQSLTQLLYSLQAVVTLQDSYYEVQKVLR
MEGPRPQPRIINENVWSPIGLHARLKQDQQLWDRECLARDKQQTQHELLLEQREQQCHLE
AERLRCERKELDAQLLEYQQNVDRLWEGQRSVEREKERVEAQQLLLQSWKHSRQSSLP
Download sequence
Identical sequences ENSGMOP00000007787 ENSGMOP00000007787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]