SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007793 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007793
Domain Number 1 Region: 769-972
Classification Level Classification E-value
Superfamily Fibronectin type III 3.61e-33
Family Fibronectin type III 0.00097
Further Details:      
 
Domain Number 2 Region: 567-757
Classification Level Classification E-value
Superfamily Fibronectin type III 6.69e-28
Family Fibronectin type III 0.00016
Further Details:      
 
Domain Number 3 Region: 236-328
Classification Level Classification E-value
Superfamily Immunoglobulin 1.73e-18
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 324-367,425-471
Classification Level Classification E-value
Superfamily Immunoglobulin 6.04e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 471-573
Classification Level Classification E-value
Superfamily Immunoglobulin 2.9e-17
Family I set domains 0.027
Further Details:      
 
Domain Number 6 Region: 13-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000207
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 119-201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000106
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007793   Gene: ENSGMOG00000007280   Transcript: ENSGMOT00000008015
Sequence length 1150
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3655:382148:417395:-1 gene:ENSGMOG00000007280 transcript:ENSGMOT00000008015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVHGLFLRSPVEQPPTITSQAASPIVAFQPDENFAVTCEAKGNPEPEFRWTKSGQEFDPL
MDPRLEKEDHSGTFVIPKNGNLSEFQGTYRCYASNNLGTAISEDMDFIVPNVPKFPKEKM
DPIIVEEGEAFILECNPPKGIPPLQIYWMTIRLEPIEQDARVSIGLNGDLYFSHAEEKDS
RRDYCCFASFPMIRTIVQKTAMSVVVNTITKSLTNNDNTSLSLKANAILERKPSLLTPPD
VRSEKQLVKGEDLELECIAEGFPTPIIKWEKLGHKLPDKARVEHHGKLLVVPSVDEGDNG
KYMCKASNSHGVAQHFFTVTVEEPPEWVQEPRSQLHTIGSDIHIKCSATGSPPPVITWRV
NGVPLEDAPAAANRERLGDVIVLRRATAGNSAVYQCHASNRHGALLANANIMIMSRDDSS
GAVEGPRFTVHRNGSLEIRVVERGDMGEYRCLTNNTEGTAAIAATLAVRDPTRIIVSPED
VQILAGSAAQLSCSAEYDKSFNNDFELLWEKDDMEIASNQTEDSRYFVEDGLLQISNVSY
EDQGRYTCVARTSIDQDRAEAMLVVLDVPDAPTNLVLSEHKNRGVKLKWSPGEDHGSSTT
EFIIEYEEGQWEPGKWKELVRVPGNHGSALLKLHGNVDYRFRVAPLNAVGKGRPSEHTER
YKTPPAAPEKNPENIKIEGHLPYEMDINWEPLLPIEHNGPGLEYKVSYRRQDLDEDWKEH
TVKRHSFIVSATPTFVPYEIKIHARNQQGWAPEPRIVSGFSGEDFPHAAPDNVTVEVMNS
SVVKVSWGRVHKDKLHGHLGGYRVNWWRLRSRTDAKKKGQHGERHTHAFPGDRGHGLLPG
LTPFSEYSLMVMSFNGRGNGPGSHVVTFRTPEGVPEKNSAFRVMEVQKHTISLAWSPPRE
PNGILTGYQLQYQSVNDTEGLGPLQTVNISDPAATKLTLKDLEALSRYRFYLRSCTTVGC
GHTVTEDSTTTAKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLGNAHQGISTQGWFIGLMSTIALLTLILLIACFVNRNKGGKYSVKEKEDLH
PDVESQGMNDDTFCEYSDNDEKPLKGSQRSLSGQMAGGESGDSLVDYGDQEVQFNEDGSF
IGEYAGHKDK
Download sequence
Identical sequences ENSGMOP00000007793 ENSGMOP00000007793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]