SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007826 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007826
Domain Number 1 Region: 11-414
Classification Level Classification E-value
Superfamily Sema domain 3.66e-140
Family Sema domain 0.000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007826   Gene: ENSGMOG00000007329   Transcript: ENSGMOT00000008055
Sequence length 417
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1288:481662:510976:-1 gene:ENSGMOG00000007329 transcript:ENSGMOT00000008055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLSDFLSPVCRDHIYTVDTETANSEEIYFSKKLTWKSRQADVDTCRMKGKHKDECHNFI
KVLLKQNNDTLFVCGTNAFNPSCRSYKMDTLEPQGEEISGMARCPYDAKHANVALFADGK
LYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPNFVQAVNYGDFIYFFFREIAM
EYNTMGKVVFPRVARVCKNDRGGSQRVLEKQWTSFLKTRLNCSIPGDSHFYFNILQAVTN
VIHINGRDVVMATFSTPYNSIPGSAVCAYDMAEIANTFTGRFKEQKSPDSTWTPVPEERV
PKPRPGCCAGTMSAEKYKLSNEFPDDTLNFVKMHPLMDEAVPSITNRPWFLKTMVRYRLT
RIAVDNEAGPYSNQTVVFLGSERGIILKFLAKMDSGFLNDSLFLEELNVYNPERVTL
Download sequence
Identical sequences ENSGMOP00000007826 ENSGMOP00000007826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]